KEGG   Nasonia vitripennis (jewel wasp): 100122312Help
Entry
100122312         CDS       T01081                                 

Definition
mitogen-activated protein kinase ERK-A-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    100122312
   04350 TGF-beta signaling pathway
    100122312
   04068 FoxO signaling pathway
    100122312
   04150 mTOR signaling pathway
    100122312
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    100122312
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100122312
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100122312
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100122312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 372 aa AA seqDB search
KDSGQQNVATVAYSYSSTTRVTSQFTSTSASGRRRRLAKMAGEGGAANAIANAEIVRGQI
FEVGPRYTNLAYMGEGAYGMVVSAYDNVTDTKVAIKKISPFEHQTYSQRTLREIKILTRF
KHENIIDIRDILRAPTIDQMKDVYIVQCLMETDLYKLLKTQAISNDHICYFLYQILRGLK
YIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHNHAGFLTEYVATRWYRAPEI
MLNSKGYTKSIDIWSVGCILAEMLSRRAIFPGKHYLDQLNHILGILGSPSPEDLECIINE
KARSYLQSLPYKPKVPWTSLFPNADPKALDLLDKMLTFNPNKRIVVEEALAHPYLEQYYD
PADEPVQRTIQI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
aaagacagcggccagcaaaacgtcgcaacagttgcgtatagctatagctcaactacccgc
gtgacgtcacaattcacatcgacgagcgccagtggtcgtcgtcgtcggctcgcgaaaatg
gcgggcgaaggtggtgcagcgaacgcgatcgcgaatgcagaaatcgtgcgcggccagata
ttcgaggtcgggccgcggtacacgaacctcgcgtacatgggcgaaggcgcctatggcatg
gtcgtctccgcgtacgacaacgtgacagacacaaaagtagccattaagaaaatttctcca
ttcgagcatcaaacctacagccaaaggacactaagagaaattaaaatcctcaccaggttt
aagcatgaaaatattatagatataagagatatattaagagcgccaactatagatcaaatg
aaggatgtatatattgttcaatgtttaatggaaactgatctttacaaattactcaaaact
caggctattagtaatgatcacatatgttactttctttatcaaattcttcgggggctgaag
tatattcactctgcaaatgtattgcatagagacctcaaacctagcaatttgcttttgaat
accacatgtgaccttaaaatttgcgattttggtctggccagagtagctgatcctgatcat
aatcatgctggttttctcacagaatatgtggcaacaagatggtacagagcacctgaaata
atgttaaactccaaggggtacacaaagtccatagatatctggtcagtaggctgcattctt
gcagagatgctgtctagacgggcgatattccctggtaaacactacctagatcagttgaat
cacattctcggtattcttggctcaccttcgcccgaagaccttgaatgcataattaacgaa
aaggcgcgcagttacttgcaatctttaccgtacaaaccaaaggttccatggacaagtttg
tttcccaatgcagatcctaaggcactcgatttattagataagatgttaactttcaatccc
aataaacgtattgtggtggaagaggcattagctcatccgtatttggaacagtattatgac
ccagctgacgaacccgtgcagaggaccattcaaatttga

DBGET integrated database retrieval system