KEGG   Nasonia vitripennis (jewel wasp): 100122411Help
Entry
100122411         CDS       T01081                                 

Definition
apoptosis 2 inhibitor-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:nvi04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 401 aa AA seqDB search
MMKTMFRTNPIGDLHRSENKMAGLLDRRDNSFMSPLKFMPNPTPRAPTPPQPESNEVDDA
GSMDYRFEEVRLQSFENWPSEHVRPADLAAAGFYFTKQIDRVRCFECSTEVCRWEQGDDP
MVEHQRWGGRCRFIRKLPCGNVPIGADPSMIPAPRPRSRDVCGPYKLDYRLGAEADTHAS
CSGTRQGRQAMSEEPPKQPSAARLGSMGIGIPRRPDFPDYASYEARLLTFNDWPSTRVSQ
TKEQLADAGFFYTGTGDQTTCYHCGGGLKNWEPKDDPWVQHAKWFSTCFYVRLVKGQEFI
NNVNGKHATPLSEEDKMALPXXXXXXXXXXXXXXXXXKPQQTSEKKSIDDARVCKICYNE
ELGVVFLPCGHMVACVKCAPGMTTCAVCREPVAMTVRAFFS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaccatgttcagaacaaacccaattggtgacctgcacaggtcagagaataag
atggctggattgctggatcgcagggacaactcgtttatgtccccactgaaatttatgcca
aatccaactcctagagcacctacgccaccccagcctgaatccaacgaggttgatgatgct
ggaagcatggactataggtttgaagaagtgagactgcagagctttgagaactggccgtca
gaacacgtgcggccagcggacctggcagctgcaggcttctacttcaccaagcagatagac
cgagtgcgttgtttcgaatgctccacggaggtctgccgctgggaacagggagacgatcct
atggtcgagcaccaacgctggggcggtcgatgccgttttatcaggaaattgccttgcggt
aacgtgcccatcggtgccgatccaagcatgatccctgctccccgtccacgaagccgtgac
gtttgcggaccgtacaagctggattatagactaggagccgaggccgacacccatgcctcg
tgtagtggaaccaggcagggcaggcaagcaatgagcgaggaaccgccgaagcagccttca
gctgccaggttgggcagtatgggcattggcattccgagacgacctgactttccggattac
gctagctacgaagcaagactgctgacctttaacgactggccgtcgacgcgcgtttcccag
acgaaagaacaactggcggatgctggatttttttacaccgggactggtgaccagactacc
tgctatcactgcggaggcggactgaaaaactgggagcccaaggacgatccgtgggtacag
cacgccaagtggttctccacctgtttctacgttcgattggtcaagggtcaggaattcatc
aataatgtaaacggaaagcacgcgacaccgctatcggaagaggataaaatggcactccca
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncaaacctcaa
cagacaagcgagaaaaagtctatcgatgatgcgcgagtttgcaagatctgctacaacgaa
gagctcggggtggtgttcctgccatgcggtcacatggtcgcctgcgtgaagtgtgccccg
ggtatgacgacgtgcgctgtttgccgggaacccgtcgctatgaccgtgcgcgccttcttc
tcctag

DBGET integrated database retrieval system