KEGG   Nasonia vitripennis (jewel wasp): 100122411Help
Entry
100122411         CDS       T01081                                 

Definition
apoptosis 1 inhibitor-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100122411
Mitochondrial biogenesis [BR:nvi03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100122411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 383 aa AA seqDB search
MMKTMFRTNPIGDLHRSENKMAGLLDRRDNSFMSPLKFMPNPTPRAPTPPQPESNEVDDA
GSMDYRFEEVRLQSFENWPSEHVRPADLAAAGFYFTKQIDRVRCFECSTEVCRWEQGDDP
MVEHQRWGGRCRFIRKLPCGNVPIGADPSMIPAPRPRSRDVCGPYKLDYRLGAEADTHAS
CSGTRQGRQAMSEEPPKQPSAARLGSMGIGIPRRPDFPDYASYEARLLTFNDWPSTRVSQ
TKEQLADAGFFYTGTGDQTTCYHCGGGLKNWEPKDDPWVQHAKWFSTCFYVRLVKGQEFI
NNVNGKHATPLSEEDKMALKPQQTSEKKSIDDARVCKICYNEELGVVFLPCGHMVACVKC
APGMTTCAVCREPVAMTVRAFFS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaccatgttcagaacaaacccaattggtgacctgcacaggtcagagaataag
atggctggattgctggatcgcagggacaactcgtttatgtccccactgaaatttatgcca
aatccaactcctagagcacctacgccaccccagcctgaatccaacgaggttgatgatgct
ggaagcatggactataggtttgaagaagtgagactgcagagctttgagaactggccgtca
gaacacgtgcggccagcggacctggcagctgcaggcttctacttcaccaagcagatagac
cgagtgcgttgtttcgaatgctccacggaggtctgccgctgggaacagggagacgatcct
atggtcgagcaccaacgctggggcggtcgatgccgttttatcaggaaattgccttgcggt
aacgtgcccatcggtgccgatccaagcatgatccctgctccccgtccacgaagccgtgac
gtttgcggaccgtacaagctggattatagactaggagccgaggccgacacccatgcctcg
tgtagtggaaccaggcagggcaggcaagcaatgagcgaggaaccgccgaagcagccttca
gctgccaggttgggcagtatgggcattggcattccgagacgacctgactttccggattac
gctagctacgaagcaagactgctgacctttaacgactggccgtcgacgcgcgtttcccag
acgaaagaacaactggcggatgctggatttttttacaccgggactggtgaccagactacc
tgctatcactgcggaggcggactgaaaaactgggagcccaaggacgatccgtgggtacag
cacgccaagtggttctccacctgtttctacgttcgattggtcaagggtcaggaattcatc
aataatgtaaacggaaagcacgcgacaccgctatcggaagaggataaaatggcactcaaa
cctcaacagacaagcgagaaaaagtctatcgatgatgcgcgagtttgcaagatctgctac
aacgaagagctcggggtggtgttcctgccatgcggtcacatggtcgcctgcgtgaagtgt
gccccgggtatgacgacgtgcgctgtttgccgggaacccgtcgctatgaccgtgcgcgcc
ttcttctcctag

DBGET integrated database retrieval system