KEGG   Nasonia vitripennis (jewel wasp): 100122447Help
Entry
100122447         CDS       T01081                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:nvi00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 185 aa AA seqDB search
MVRAWYMDESLADQRLEHHRQPPEFLSLEELFRRTGVEHFEVNYKDYENDETLKSLREKR
GYSYEDEITCSKECLQNYEEKLKNFFTEHLHTDEEIRLVLDGSGYFDVRDDKDQWIRIEV
KAGDLIIIPSGIYHRFTLDVNDYIKAKRYFVGEPVWLPYNRPVDEMECRRQYLERLKNGF
QVPVA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcgcttggtacatggacgagagtctggccgaccagcggctggagcatcaccgg
caaccgcccgagttcctcagtctcgaggaactgttccggcgcaccggggtcgagcatttt
gaggtcaactacaaagattatgaaaatgatgaaactttgaagagcttgagagaaaaaagg
ggatacagttatgaagatgaaatcacatgctctaaggaatgtttgcagaattatgaggaa
aagttgaaaaattttttcaccgaacacttgcacacagatgaagaaattcgtcttgtgctt
gatggatctggttactttgatgttcgagatgacaaggatcagtggattcgtattgaagta
aaagctggagatttgatcatcattccaagtggcatttaccacagattcacgttggacgtg
aatgattacattaaagctaagagatactttgttggagaacccgtttggctaccctacaac
agaccagtggatgaaatggaatgcagaagacaatatttagagcgcttgaagaatggtttc
caagtcccagtagcttaa

DBGET integrated database retrieval system