KEGG   Nasonia vitripennis (jewel wasp): 100122586Help
Entry
100122586         CDS       T01081                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100122586
   00052 Galactose metabolism
    100122586
   00500 Starch and sucrose metabolism
    100122586
   00520 Amino sugar and nucleotide sugar metabolism
    100122586
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100122586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 510 aa AA seqDB search
MLSVDDRKTRGHQRSPSDTQAFKERTKRDALIDLETELSKISASATNPLEKEAIEQQNDG
FKRLFERFLEEDGPSLNWDQIQRLPEGAIKNYDNLQDPGTEEIKQLLSKLVVVKLNGGLG
TSMGCHGPKSVISVRNGLTFLDLTVQQLENLNKTYGSNVPLVLMNSFNTDDDTQKIIRKY
KGIDVEIHTFNQSCYPRINKESLLPIAKHCKIHDDMESWYPPGHGDFYESFRNSGLLKLF
LAQGRQYCFISNIDNLGATVDLRVLRLLLGPENTAQIEFLMEVTDKTRADVKGGTLIQYE
DKLRLLEIAQVPKEHVEDFKSVKTFKYFNTNNLWIKLAAIERILGSDGLQLEIIVNNKTF
ENGLNVIQLETAVGAAMKNFNGACGIHVPRSRFLPVKKTSDLLLVMSNLYILRNGFLSMS
PQRMFPTTPLVKLGDNHFSKVKEFLNRFPTIPDILELDHLTVSGDVTFGRKVTLKGTVII
IANQGERIDLPSGTILENKIVSGNLRILDH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtgtcgacgacagaaagaccagaggtcatcagcgcagtccgtcggacacgcag
gcgttcaaggaaagaacgaagcgagatgctctcattgatctggagactgagctgagcaaa
atttcggcctctgctaccaacccactcgagaaggaagccatcgaacaacagaacgatggt
ttcaagcggcttttcgagaggttcctcgaggaggatggaccttcgctcaactgggaccag
attcaaagattgccagagggggcgattaaaaactacgacaatctccaagacccgggaacg
gaggagatcaaacagttgctgagcaaattggtcgtggtgaaattgaacggtggtcttgga
acgagtatgggatgccacgggccaaaatccgtcatttccgttcgtaatggtcttacgttt
ttggacttgaccgttcaacagctggagaatttgaacaaaacctacgggtccaacgtgcct
ctagtcttaatgaattccttcaacacggacgatgatacgcaaaaaatcatcaggaagtac
aaaggaatcgatgttgaaatccacacgttcaatcagagctgctatcctcgtatcaataag
gaatctctgttgccaatcgctaaacactgtaaaatacacgacgacatggaatcctggtac
cctcctggacacggagacttttacgaaagtttcaggaattcgggtttattgaaattattc
ctggctcaagggcgtcaatattgctttatttcaaacatcgacaatttaggagctacggtt
gatttgagagttttgaggctactgttaggacctgaaaataccgcacaaattgaattcctc
atggaagtgacagataaaacgagggcagacgtcaagggtggcacactaattcagtatgaa
gataaacttcgacttcttgaaatagcacaagttcccaaagaacacgtagaagactttaaa
tctgtgaaaacgttcaaatatttcaatacgaataatttatggataaaactcgctgctatt
gaaagaattctgggtagcgatgggcttcaattggaaatcattgtaaataataaaactttt
gaaaacggtttgaacgtgattcaactcgaaactgcagtaggtgcagctatgaaaaatttc
aacggagcttgcggtattcacgtaccacgtagcagatttttacccgtcaaaaagacttca
gatttgcttcttgtcatgagtaatttgtacatattacgtaatggtttcttgtcaatgtca
ccgcaaaggatgttcccgaccacgcctttagttaagcttggagataaccatttttcaaag
gtaaaagaatttctgaacagatttccaacgattcctgacatcttagaactggatcacttg
acagtttctggcgatgtcacatttggcagaaaagttactctaaaaggaactgtaatcatc
atagcaaatcaaggagaaaggatagatctcccatcaggcacaattctcgaaaataagatt
gtttctggaaacttgcgaattttagatcactga

DBGET integrated database retrieval system