KEGG   Nasonia vitripennis (jewel wasp): 100122689Help
Entry
100122689         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase 5
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100122689
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100122689
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100122689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 801 aa AA seqDB search
MEELTKHLEKVKIPTPNDKIYKDECVLSFDTPETPTGLYLSLTTFLGFGVDYVSDYFQRT
GNSVFLHITRIKHEIPAEQTEDGPDKKITRLAIGTPGGFNPDVQKYNYEEKYEIVLMPGF
VRIPYPNEDLPKPVKISIEAVLQAESALKIAEKEALAGTWDGEARVITRHLHLTQLNNNK
KVPPSGWKCERCDLTTNLWLNLTDGAILCGRKFYDGTGGNDHAVEHFRNTGYPLAVKLGT
IARDGKADVYSYDEDDMVEDPNLAVHLAHWGINLAHMEKTDKSMVELELELNQKFGDWIA
MQEGNNKLTPMYGPGYTGLVNLGNSCYMNSVMQMSFTIPDFVDRFVSKANEIFNQNLNDP
PNDFNTQMAKLGVGLLSGKYSQQPESKTDDENRQGIPPRMFKNLIGRGHPGFSSNRQQDA
QEFILHLINILDRNSRHQTNPADCFKFKVEERYQCSSGKVKYTHRPEYLLPIPIPMDMVL
NKEEVAAYEAEKNKTDEDKAKFDPNLIVRPRIKLSSCLESFAKTEIVEQFYSSALNDKTT
ATKTTRLASFPDYLLLHLKKFTVKEDWTPIKLDVAVEMPDLLDLNFLRGNGLQPTEELLP
ESNAAPPIVYDQVLLGQLADMGFPVEACKRSLYFTENRGLDSATQWLMEHISDADFSDPF
VPPGVDAKSGKNSAAFVPNKESLEMVMSMGFTKEQATKALKATNNNLERAADWVFSHSSE
LDTLDMDVDAQPPEPSFRDGSGKYKLVGFVTHMGTSTMVGHYVCHLLKDGQWVIFNDEKV
YASEKPLKELGYIYLYQRLDK
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactgacaaagcacttggaaaaagtaaaaatacccactccaaatgataagatt
tataaggatgaatgcgtactatcttttgatactccagaaacgccaactggtttatacttg
agtttgacaacttttttgggatttggcgttgattatgtatcagactattttcaacgcact
ggaaattcagtatttctccatattactaggataaaacatgaaataccagctgaacaaaca
gaagatggtccagacaaaaagattacacgcctagcaatcgggactccaggtggattcaat
ccagatgtacaaaagtacaactacgaggaaaagtatgaaatagtattaatgccaggtttt
gtaagaattccatatcctaatgaagatttgccaaagcctgtaaaaatttccattgaggct
gttttacaagcagagtctgctttgaaaattgctgaaaaagaagccctagctggtacttgg
gatggagaagcaagagtaattacaagacacttacatctgacccagttgaacaataacaaa
aaggtaccaccaagtggttggaaatgtgagagatgtgatctcactacaaacttatggcta
aatttaaccgatggcgcaatcctgtgtggaaggaaattttatgatggcactggtggaaat
gaccatgctgtggaacattttagaaacactggatatccacttgctgtcaagctaggaact
attgctagagatggaaaagcggatgtttattcatacgatgaggatgatatggttgaagat
cctaatttagctgttcacctagctcattgggggataaatcttgcccatatggagaagact
gataagtcaatggttgaactggagttagaactcaatcagaagtttggagactggattgcc
atgcaagaaggaaacaataaactcacacccatgtacggccctggttatacaggacttgta
aatttgggaaactcctgttacatgaatagtgttatgcaaatgtcttttactataccagat
tttgttgacagatttgtcagtaaggctaacgaaatatttaatcaaaatttgaacgatcct
ccaaacgattttaatacgcagatggctaaattgggagttggtttactttctggaaagtac
tcacagcaaccagaatctaaaacagatgacgaaaatcgccaaggcataccaccgagaatg
tttaaaaatctaataggtcgtggtcatcctggcttttcgtctaatcgccagcaagatgca
caggaatttatattgcatttaattaatatcttggatagaaacagtcgtcatcaaactaat
ccagctgactgtttcaaattcaaagttgaagaaagatatcaatgtagttctggaaaggtc
aaatacacacataggccagaatatttattacctattcccataccaatggacatggtttta
aataaggaggaagttgcagcgtatgaagctgaaaaaaataaaactgatgaagataaagcc
aaattcgatcctaatcttattgtaaggccacgtataaaactgtcctcttgtttagagagt
tttgcaaaaactgaaattgttgaacaattttacagttctgctttaaatgataaaaccact
gccactaaaaccacaagactagcgtcatttcccgattatctcttgttacacttgaagaaa
ttcactgtgaaagaagactggacacctattaaattagacgtggctgttgagatgccagac
cttttagatttgaactttttgagaggcaatggactgcagccaactgaagagttattgcct
gaatcaaatgcggctcctccaatcgtttacgaccaggttcttcttggtcaattagcagat
atgggtttcccagtcgaagcctgtaaaagatctttgtatttcacggaaaatcgtggatta
gattcagcaacacagtggttgatggaacatatttcggatgctgatttttcagatcctttt
gtgcccccaggagtagacgcaaaatcgggtaaaaattctgccgcttttgtaccaaataaa
gaatctttagaaatggtgatgagtatgggctttaccaaagagcaagctactaaagcccta
aaagccactaacaacaatctcgagcgtgccgctgattgggtatttagtcattcttctgaa
ctagacactttggatatggatgtagatgcacagccgccagagccttcattcagggatggc
agtggaaaatataaactggtgggattcgtcacccatatgggtacatcaacaatggtaggg
cattacgtgtgtcatttgctgaaggatggtcaatgggtgatctttaatgatgaaaaggtt
tacgcgtctgaaaagccgctgaaagaattaggatatatttatttgtatcaacgtctggac
aagtag

DBGET integrated database retrieval system