KEGG   Nasonia vitripennis (jewel wasp): 100122713Help
Entry
100122713         CDS       T01081                                 

Definition
eukaryotic translation initiation factor 3 subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100122713
Translation factors [BR:nvi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100122713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 233 aa AA seqDB search
MDDWDSDKIEAQFEDHLALRSNKWEGEDEEEEVLESWEDMNDEKKDVEKVPAEVPKAKPK
PKKTLAEKIEERERRAREEAEQKAKEKEEALTPEERRAEMLRRQKLQEEADLRLAMETFG
VTEGSSGIDAMMPTNADEFKEFADALLTKINQFNKHTDFPLFAEELIKNICLTLPVTSLR
KIKTTVESLHTEKAKMDKEKAKKNKGKGKAKLKMDGDELGDFGSYDNDYDDFM
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggacgactgggattccgacaagatcgaggcgcagttcgaggaccacctcgcgttgcgt
tccaacaaatgggagggcgaggacgaggaggaggaagtcctggaaagctgggaagatatg
aacgatgagaaaaaggatgttgagaaagtccctgcagaagtcccaaaggcaaagccaaag
cctaagaaaactttagccgagaaaattgaagagcgtgagagaagagctcgtgaagaagcc
gagcaaaaggcaaaggaaaaggaagaagctctgacaccagaagagagaagagctgagatg
ctcagaaggcaaaaactgcaagaggaagccgatctgcgacttgctatggaaactttcgga
gtgacagaaggatcttcaggcattgacgctatgatgccaacaaacgcagatgaatttaag
gagttcgctgatgcgttattaacgaaaatcaaccagttcaataaacacacagatttccca
ttgttcgcagaagaattaataaagaatatttgcctgactcttccagttacttctttgagg
aaaataaaaacaacggtagaaagtttgcacactgaaaaagcaaaaatggataaggaaaag
gcaaagaagaataagggcaaaggaaaagctaaactgaagatggacggtgacgagctcggt
gatttcggatcgtatgacaacgactatgatgactttatgtag

DBGET integrated database retrieval system