KEGG   Nasonia vitripennis (jewel wasp): 100122732Help
Entry
100122732         CDS       T01081                                 

Definition
(RefSeq) histone H2B-like
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 124 aa AA seqDB search
MAPKASGKAVKKAGKAVKNITKGDKKKHKKRRKESYAIYIYKVLKQVHPDTGVSSKAMSI
MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaaggctagcggaaaggcggtgaagaaggccggcaaggccgtgaagaacatc
accaagggcgacaagaagaagcacaagaagcgcaggaaggagagctacgcgatctacatc
tacaaggtgctgaagcaggtccaccctgacaccggcgtgtcgagcaaggccatgagcatc
atgaacagcttcgtcaacgacatcttcgagcgcatcgccgccgaggcctcccggctggcc
cactacaacaagaggtcgaccatcacctcccgggagatccagacggccgtcaggctcctg
ctccccggtgaactggccaagcacgccgtcagtgagggcaccaaggccgtcaccaagtac
accagctccaaataa

DBGET integrated database retrieval system