KEGG   Nasonia vitripennis (jewel wasp): 100122823Help
Entry
100122823         CDS       T01081                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100122823
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100122823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 474 aa AA seqDB search
MTAILGGGISGLSAAYYAVEHSKLGSIVLYEASNRLGGWIRSVTAPSGVIFEKGPRTIRS
EGAAGENTLQLISDLNLSDKVVAVKMFHPAARNRLIYVNEKLHLLPNSLGGLLKIQEPFK
RRLASIIWTDLRAPKEIKEDESIYSFVERRMGKDVADYLISPMICGICAGDAKQISVNFL
LKSAFEFEQKHGSMTKGLLLNLLKKKSNQSTNKNKASSTKSHLVEKSKLEKWSVWGLRGG
LEQFPIALSNSLKSKSNLSLKTKTNCEQITFKPGQVELSVNGKAEKHLRVVSSLSAKSLA
PLLKRQHPQLSRELEAIPCATVAVVNLHFNGDVLPLEGFGFLVAPSENLPILGVIFDSCV
FSNENNTTVLTVMMGGAWFDKYFGKSVTNDQLLSTAVKHTKNILKIQEDPVEVDVAVLKD
CIPQYVVGHSQRMQRIQNYISSHKIPLVLCGSSYHGVGLNDVILSAKRAISDIV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacagctattttagggggaggaatatcgggcctaagtgcagcatattacgctgtcgaa
cactcaaaattagggtcgattgttctctatgaagcatctaatcgtttaggaggatggata
agaagtgtaacagcacccagtggagtgatatttgagaaaggtcctcgcaccatcagatct
gaaggcgctgctggagaaaatactctgcaacttataagtgatctcaacttgagtgacaaa
gttgttgcagtcaaaatgtttcatccagctgccagaaacagactgatttatgtaaatgaa
aaattgcacctattgcctaattcactgggtggtttgttaaaaattcaagaaccatttaag
agacgtttggcttcaataatatggactgacttaagagctccgaaagaaataaaggaagac
gaaagtatttatagttttgttgaaagaagaatgggaaaagacgttgctgattacttaatc
agtccaatgatttgcggaatatgcgctggagatgcaaagcaaataagtgttaactttttg
ctgaaaagtgcctttgaattcgaacagaagcacggttcaatgactaagggtcttttgttg
aatctgttaaaaaaaaaatctaatcaaagtacaaacaaaaataaagcaagttcaaccaag
tcacatttagttgaaaagtctaagctagagaaatggtcagtttggggtcttagaggaggg
ttagaacaatttcctatagcattgagtaattccttaaaatctaagtctaatttatcttta
aaaactaaaacgaattgcgaacaaatcacattcaaaccaggtcaggtggaattatccgtg
aatgggaaagctgaaaaacatctaagagtggtctcaagtttgtcagcaaagagtcttgct
cccttgcttaaaagacagcatccacaattgtcaagggagctagaagcaataccatgtgcc
actgtagctgtagttaatcttcattttaatggagacgttttgccattggaaggttttgga
tttcttgtagcaccatctgaaaatttgcctattctaggagttatctttgattcgtgtgtc
tttagcaatgagaataatactacagtactaacggtaatgatgggtggagcatggtttgac
aaatactttggaaagagcgtaacaaatgaccaactcctatctacagcagttaagcatacg
aaaaatatacttaaaatacaagaagatccagtcgaggtcgatgtagctgtgttgaaggac
tgtattccacagtacgtggttggtcatagtcaaagaatgcagcgcattcaaaactatatc
tcctcgcataaaatccctttggtgctctgcggatcgtcatatcacggggttggtctgaac
gacgttattctgtcagcaaaacgagccatttccgacattgtttaa

DBGET integrated database retrieval system