KEGG   Nasonia vitripennis (jewel wasp): 100122823Help
Entry
100122823         CDS       T01081                                 

Definition
protoporphyrinogen oxidase-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nvi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 474 aa AA seqDB search
MTAILGGGISGLSAAYYAVEHSKLGSIVLYEASNRLGGWIRSVTAPSGVIFEKGPRTIRS
EGAAGENTLQLISDLNLSDKVVAVKMFHPAARNRLIYVNEKLHLLPNSLGGLLKIQEPFK
RRLASIIWTDLRAPKEIKEDESIYSFVERRMGKDVADYLISPMICGICAGDAKQISVNFL
LKSAFEFEQKHGSMTKGLLLNLLKKKSNQSTNKNKASSTKSHLVEKSKLEKWSVWGLRGG
LEQFPIALSNSLKSKSNLSLKTKTNCEQITFKPGQVELSVNGKAEKHLRVVSSLSAKSLA
PLLKRQHPQLSRELEAIPCATVAVVNLHFNGDVLPLEGFGFLVAPSENLPILGVIFDSCV
FSNENNTTVLTVMMGGAWFDKYFGKSVTNDQLLSTAVKHTKNILKIQEDPVEVDVAVLKD
CIPQYVVGHSQRMQRIQNYISSHKIPLVLCGSSYHGVGLNDVILSAKRAISDIV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacagctattttagggggaggaatatcgggcctaagtgcagcatattacgctgtcgaa
cactcaaaattagggtcgattgttctctatgaagcatctaatcgtttaggaggatggata
agaagtgtaacagcacccagtggagtgatatttgagaaaggtcctcgcaccatcagatct
gaaggcgctgctggagaaaatactctgcaacttataagtgatctcaacttgagtgacaaa
gttgttgcagtcaaaatgtttcatccagctgccagaaacagactgatttatgtaaatgaa
aaattgcacctattgcctaattcactgggtggtttgttaaaaattcaagaaccatttaag
agacgtttggcttcaataatatggactgacttaagagctccgaaagaaataaaggaagac
gaaagtatttatagttttgttgaaagaagaatgggaaaagacgttgctgattacttaatc
agtccaatgatttgcggaatatgcgctggagatgcaaagcaaataagtgttaactttttg
ctgaaaagtgcctttgaattcgaacagaagcacggttcaatgactaagggtcttttgttg
aatctgttaaaaaaaaaatctaatcaaagtacaaacaaaaataaagcaagttcaaccaag
tcacatttagttgaaaagtctaagctagagaaatggtcagtttggggtcttagaggaggg
ttagaacaatttcctatagcattgagtaattccttaaaatctaagtctaatttatcttta
aaaactaaaacgaattgcgaacaaatcacattcaaaccaggtcaggtggaattatccgtg
aatgggaaagctgaaaaacatctaagagtggtctcaagtttgtcagcaaagagtcttgct
cccttgcttaaaagacagcatccacaattgtcaagggagctagaagcaataccatgtgcc
actgtagctgtagttaatcttcattttaatggagacgttttgccattggaaggttttgga
tttcttgtagcaccatctgaaaatttgcctattctaggagttatctttgattcgtgtgtc
tttagcaatgagaataatactacagtactaacggtaatgatgggtggagcatggtttgac
aaatactttggaaagagcgtaacaaatgaccaactcctatctacagcagttaagcatacg
aaaaatatacttaaaatacaagaagatccagtcgaggtcgatgtagctgtgttgaaggac
tgtattccacagtacgtggttggtcatagtcaaagaatgcagcgcattcaaaactatatc
tcctcgcataaaatccctttggtgctctgcggatcgtcatatcacggggttggtctgaac
gacgttattctgtcagcaaaacgagccatttccgacattgtttaa

DBGET integrated database retrieval system