KEGG   Nasonia vitripennis (jewel wasp): 100122829Help
Entry
100122829         CDS       T01081                                 

Definition
histone H2B.1/H2B.2-like
Orthology
K11252  
histone H2B
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100122829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 124 aa AA seqDB search
MAPKASGKAVKKAGKAVKNITKGDKKKHKKRRKESYAIYIYKVLKQVHPDTGVSSKAMSI
MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaaagcaagcggaaaggcagtcaagaaagccggcaaggccgttaaaaacatc
accaagggtgacaagaagaagcacaagaagaggaggaaggagagctacgccatctacatc
tacaaggtgctgaagcaggtccatcccgacaccggagtctccagcaaggccatgagtatc
atgaacagctttgtaaacgacatcttcgagcgcatcgccgccgaggcttcgcgtctggcc
cattacaacaagagatcgacaatcacctcccgggagattcagacggccgttcggctcctg
ctccccggtgaactggccaagcacgctgtcagtgaaggcaccaaagccgtcaccaagtac
accagctccaagtaa

DBGET integrated database retrieval system