KEGG   Nasonia vitripennis (jewel wasp): 100122899Help
Entry
100122899         CDS       T01081                                 

Definition
histone acetyltransferase Tip60
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100122899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 457 aa AA seqDB search
MIEEHEEGETVCDSGTALVEGCRLKVRMSGTDDWPEAEIISIKDENGLRNYYIHYLAFNK
RLDEWVTEEYLDTREVTFPKRDGSTAPGTGAATPKKLISSRPQSPTIVNNELVNGSAVLQ
AALQKKMARKRKANFLENEDSQDGTTQQPTAGPRPTGSLVAHHHDDVVTRMKNIELIELG
RHRIKPWYFSPYPQEMVNLNCIYICEFCLKYRKSRKCLERHLAKCNLRHPPGNEIYRKGS
ISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDTRGFHIVGYFSKE
KESTEDYNVACILTMPQFQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYW
THTILDILLNVKPVGENNEKPTITINEICELTSIKKEDVISTLQKHNLINYYKGQYIVTL
NREIIDQHMAAMEKRKIRIDPKCLHWTPKDWSIRAKW
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagaacacgaggaaggggaaacagtatgtgactcggggactgcactggtagaa
ggatgtcgtttaaaagtgcgaatgagtggcacagacgactggcctgaggcggagatcata
agcataaaagacgaaaatggcttgaggaattattacattcactatttagctttcaacaaa
aggttagacgaatgggtaaccgaagaatacttagatactcgagaagttacattcccaaaa
cgagatggatctactgcacccgggactggagcagctactccaaaaaagttaatatctagc
agaccacaaagcccgacaattgtaaataatgagctggttaacggatcagcagtgctgcaa
gcagcattgcaaaagaaaatggccagaaagagaaaagcaaattttctcgaaaatgaagac
tcccaagatggaacaacacagcaacccacagctggtccacgtccaaccggttcactggtc
gcacatcatcacgatgatgtagtcacaagaatgaagaatatagaactcattgaacttggt
agacacagaataaaaccatggtacttcagtccataccctcaagaaatggttaatcttaat
tgtatatacatttgtgaattctgcttgaaatatcgcaagagtcggaagtgtttagaaaga
catttagctaaatgcaatctacgtcatccaccaggcaatgagatatatcgaaagggatca
atatcgttctttgaaatagatggaagaaaaaacaagaattatgcccaaaacctttgcttg
ctggcaaaattatttctcgaccataaaactctgtattatgacacggatccatttttattt
tatgtgatgacagaatttgacactcgaggatttcacatagtgggttatttttccaaagaa
aaggagtcaacagaagattacaatgtagcttgtattcttactatgcctcagtttcagagg
aaaggctatggaaaacttttgatcgaattttcttatgaactttcgaaatttgaaggaaaa
acgggttctcctgaaaaaccactttcagatttaggattattatcttaccgtagctattgg
actcacacaatactggacattttgctcaatgtcaaacctgttggcgagaacaatgaaaag
ccgacaataacgataaatgaaatttgtgaactgacttcaattaaaaaggaagatgtgatc
tcaactttacaaaaacataacctcatcaactattataagggacaatatatcgttacatta
aatagggaaataatcgatcaacacatggcagcaatggaaaaaagaaaaataagaatagat
ccgaaatgtttgcattggacaccaaaggattggagtattcgggcaaagtggtga

DBGET integrated database retrieval system