KEGG   Nasonia vitripennis (jewel wasp): 100122921Help
Entry
100122921         CDS       T01081                                 

Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:nvi00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 580 aa AA seqDB search
MTRLKGRTSMTIILMIVFALLIIVYHIVSSEVEDVSSTKLRPHAKLDDEDFTDNPNDALR
RQKLEAQMMGNLRSNNRFGDFDKDVDRSSYEINSLYKGHKIVHLDLKGAPPVINYYKYLF
PLIKKLGATGVLIEYEDMFPFKDDLGGISAENCYSKSEIMAIQEIAKENNLIIIPLIQTF
GHLEFVLKLKKYIDYREVVRYPQVVCPTYNKTIHLIYNMIDQVVAMHPHIKYLHIGADEV
YQLGECNRCLEVMSRYQWTKRQLFLNHVHVVASYIKKKYPHLTVLMWDDEFREIDPQEII
DKGLNKLVEPVVWKYTTDPVSALTDQLWENYAIVWKSVWVATAFKGATAPDRYYTDISYH
MENHQRWLEIIARQSKHLHFRGVMLTGWQRYDHFSVLCELLPSALPSLAINLMVLQSSDY
TTFPVEVPRKIMEILSCDGIITLSLPEPQYGWTKCNYFGASVYSATLRLHSLCQEIARME
QDSTFKGWLKPYNIKYAFSNPSHVERAVAELDRYKMEIIYIEKEMKSAMEGIYTNYTVQE
WLETYLYPLNDKVMALWDAKEKILERDSWPRRPLTKPPDL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcttgaagggccgaacgtcaatgacaatcatcttaatgattgtgtttgcttta
ttaatcattgtctaccacatagtcagtagcgaagtcgaggacgtctcgtcgaccaagctt
cgtccacacgctaaattggacgatgaagattttaccgataatccgaacgatgctctgaga
agacagaaattagaggcccaaatgatgggtaatttgagatctaataatagatttggagat
tttgataaagacgtagatagaagttcgtatgaaattaactccctttataaagggcataaa
atagtacatctagatctaaaaggtgctcctccagtgattaattattataagtatctgttc
ccactgataaagaagttgggagccacgggagtactcatagagtacgaggacatgtttcca
tttaaagatgacctaggtggcatcagtgctgaaaattgttactccaagagtgaaataatg
gcaatacaagaaatagccaaagagaacaacctcattattatcccattgattcaaactttt
ggccacttagaatttgttttaaagcttaaaaagtatattgattatcgagaagttgtccgt
tatccccaagttgtatgccctacgtacaataaaactatacatctcatctacaacatgata
gatcaagttgttgccatgcatcctcacataaagtatttacatattggggcagacgaagtt
tatcagttaggggagtgtaataggtgtttagaagtaatgtcaagatatcaatggactaag
aggcagttatttcttaatcatgtgcacgttgtagcatcttacattaaaaaaaagtacccc
cacctcacagttctcatgtgggatgatgaattcagagaaatagatccgcaggagattatt
gataaaggcttaaataaattagtggaaccagttgtatggaaatatacaacggatcctgta
tctgcattgactgatcagttgtgggaaaattatgcaatagtttggaaatcagtttgggtg
gcaactgcatttaaaggtgcaacagcacctgatagatattatacagatatatcctatcac
atggaaaatcatcaacgctggttagagattattgctaggcaatcaaagcatttgcacttt
cgaggggtaatgctcactggctggcagaggtatgatcactttagtgttttgtgtgaacta
ttaccgtcagcactgccatcgctagcaatcaatttaatggttctgcagtcttcggattac
accacctttcctgttgaagtacctcgaaaaattatggaaattttaagctgtgatggtata
attactttaagtcttccagaaccacagtatggatggacaaagtgtaactattttggagct
tccgtatactctgcaacacttcgcctccattcattgtgccaagaaatcgctaggatggaa
caggatagtacattcaagggctggttgaagccgtataatatcaagtatgctttttcaaat
cctagtcatgtagagagagcagtggctgagcttgacagatacaaaatggaaatcatctac
atcgagaaagagatgaaaagtgcgatggaaggaatttataccaattatacggttcaagaa
tggttggaaacttacttgtatcctttaaacgacaaagtcatggccttatgggatgctaaa
gagaaaatactcgagagggattcgtggcctaggagaccactaacaaagcctccagactta
taa

DBGET integrated database retrieval system