KEGG   Nasonia vitripennis (jewel wasp): 100122921Help
Entry
100122921         CDS       T01081                                 

Definition
(RefSeq) hexosaminidase D-like
  KO
K14459  hexosaminidase [EC:3.2.1.52]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00511  Other glycan degradation
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100122921
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100122921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 DUF4838 SPC22
Motif
Other DBs
NCBI-GeneID: 100122921
NCBI-ProteinID: XP_008211560
NASONIABASE: NV11519
UniProt: K7IR30
Position
4
AA seq 580 aa AA seqDB search
MTRLKGRTSMTIILMIVFALLIIVYHIVSSEVEDVSSTKLRPHAKLDDEDFTDNPNDALR
RQKLEAQMMGNLRSNNRFGDFDKDVDRSSYEINSLYKGHKIVHLDLKGAPPVINYYKYLF
PLIKKLGATGVLIEYEDMFPFKDDLGGISAENCYSKSEIMAIQEIAKENNLIIIPLIQTF
GHLEFVLKLKKYIDYREVVRYPQVVCPTYNKTIHLIYNMIDQVVAMHPHIKYLHIGADEV
YQLGECNRCLEVMSRYQWTKRQLFLNHVHVVASYIKKKYPHLTVLMWDDEFREIDPQEII
DKGLNKLVEPVVWKYTTDPVSALTDQLWENYAIVWKSVWVATAFKGATAPDRYYTDISYH
MENHQRWLEIIARQSKHLHFRGVMLTGWQRYDHFSVLCELLPSALPSLAINLMVLQSSDY
TTFPVEVPRKIMEILSCDGIITLSLPEPQYGWTKCNYFGASVYSATLRLHSLCQEIARME
QDSTFKGWLKPYNIKYAFSNPSHVERAVAELDRYKMEIIYIEKEMKSAMEGIYTNYTVQE
WLETYLYPLNDKVMALWDAKEKILERDSWPRRPLTKPPDL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcttgaagggccgaacgtcaatgacaatcatcttaatgattgtgtttgcttta
ttaatcattgtctaccacatagtcagtagcgaagtcgaggacgtctcgtcgaccaagctt
cgtccacacgctaaattggacgatgaagattttaccgataatccgaacgatgctctgaga
agacagaaattagaggcccaaatgatgggtaatttgagatctaataatagatttggagat
tttgataaagacgtagatagaagttcgtatgaaattaactccctttataaagggcataaa
atagtacatctagatctaaaaggtgctcctccagtgattaattattataagtatctgttc
ccactgataaagaagttgggagccacgggagtactcatagagtacgaggacatgtttcca
tttaaagatgacctaggtggcatcagtgctgaaaattgttactccaagagtgaaataatg
gcaatacaagaaatagccaaagagaacaacctcattattatcccattgattcaaactttt
ggccacttagaatttgttttaaagcttaaaaagtatattgattatcgagaagttgtccgt
tatccccaagttgtatgccctacgtacaataaaactatacatctcatctacaacatgata
gatcaagttgttgccatgcatcctcacataaagtatttacatattggggcagacgaagtt
tatcagttaggggagtgtaataggtgtttagaagtaatgtcaagatatcaatggactaag
aggcagttatttcttaatcatgtgcacgttgtagcatcttacattaaaaaaaagtacccc
cacctcacagttctcatgtgggatgatgaattcagagaaatagatccgcaggagattatt
gataaaggcttaaataaattagtggaaccagttgtatggaaatatacaacggatcctgta
tctgcattgactgatcagttgtgggaaaattatgcaatagtttggaaatcagtttgggtg
gcaactgcatttaaaggtgcaacagcacctgatagatattatacagatatatcctatcac
atggaaaatcatcaacgctggttagagattattgctaggcaatcaaagcatttgcacttt
cgaggggtaatgctcactggctggcagaggtatgatcactttagtgttttgtgtgaacta
ttaccgtcagcactgccatcgctagcaatcaatttaatggttctgcagtcttcggattac
accacctttcctgttgaagtacctcgaaaaattatggaaattttaagctgtgatggtata
attactttaagtcttccagaaccacagtatggatggacaaagtgtaactattttggagct
tccgtatactctgcaacacttcgcctccattcattgtgccaagaaatcgctaggatggaa
caggatagtacattcaagggctggttgaagccgtataatatcaagtatgctttttcaaat
cctagtcatgtagagagagcagtggctgagcttgacagatacaaaatggaaatcatctac
atcgagaaagagatgaaaagtgcgatggaaggaatttataccaattatacggttcaagaa
tggttggaaacttacttgtatcctttaaacgacaaagtcatggccttatgggatgctaaa
gagaaaatactcgagagggattcgtggcctaggagaccactaacaaagcctccagactta
taa

DBGET integrated database retrieval system