KEGG   Nasonia vitripennis (jewel wasp): 100122952Help
Entry
100122952         CDS       T01081                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:nvi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nvi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nvi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nvi00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 489 aa AA seqDB search
MLRTTTSLRHELAKATLRSTVRSNVVRCLGTQCLHKRHQQRPLIHKSSRFALQPWQQNLR
YYADYPDHIKVPLPALSPTMETGTIISWQKKEGDKLNEGDLLAEIETDKATMGFETPEEG
YLAKILVPAGEKNVTIGRLVCIIVADEGSVAAFKDYKDDGSTVAAAPPSAPAPPPPAAPA
AVPPPPKAAAPAAVSTPSLATSGERVFASPLARRLASEQGLSLQGLKGSGLFGSVTAKDL
AGASPAGVGAPAGAAVAAPGGKDIPISNVRGVIAKRLLESKQTIPHYYLTIEVKMDEALS
MRQQFNKLLEKEKIKLSVNDLIIKGMAMACKKVPEGNSAWLGDKIRQYDHVDVSVAVSTD
NGLITPIVFGADVKGIVQISNDVKALAAKAREGKLQPHEFQGGTITVSNLGMFGIKSFSA
IINPPQSIILAIGTTETRLVPADNEKGFTTAQYMCVTASCDHRTVDGAVGAQWLTAFKNF
MENPTTMLL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggacgacgacgagcctgcgccacgagctggccaaggcgacccttcgtagcacc
gtccggagcaacgtcgtcaggtgcctgggtactcagtgcctgcacaaaaggcaccagcag
aggccactaattcacaaaagctcaaggtttgcattacaaccatggcaacaaaatctacga
tactacgccgactacccagatcacataaaggtcccgctgcctgctctgtcgcccacaatg
gaaacaggaactatcatctcctggcagaaaaaagaaggtgacaagttgaacgagggtgac
ttgttagcggaaatcgagaccgacaaggctacgatgggcttcgagacgccagaggagggt
tacctggccaagatcctggtaccggccggtgaaaagaatgtgacgatcggtcgtctagtc
tgcatcattgttgccgacgagggtagcgtagctgccttcaaggactacaaagatgacggc
tcgacagtcgccgcggctcctccgtccgctccagcacctccgccaccagcggcacccgct
gctgtgccgcctccaccgaaagctgctgctcccgcagctgtctccacgccgtccttagct
acgtcgggtgagagggtgtttgccagcccactcgcaagaagactggcttctgagcagggt
ctcagtttacagggtttgaaaggcagtggcctattcggttcagtgacagccaaggacttg
gctggtgcttcccctgctggagttggagcaccagcaggagccgcagtcgccgcacccggt
ggcaaggatattcccatttccaacgttcgtggagtcattgccaaacgtctgctggagagc
aaacagacgataccccattactacctgaccatcgaggtgaaaatggacgaggctctatcg
atgaggcaacagttcaacaaattgcttgagaaagagaagatcaagcttagcgtcaatgac
cttatcatcaagggtatggctatggcgtgcaaaaaagtgccggagggcaacagcgcttgg
ctcggagacaaaattcgacagtatgatcacgtagatgttagcgtagctgtcagtacagac
aatgggctcataacgcctatcgtctttggagccgacgtaaaaggcatagttcaaattagc
aacgatgtaaaagcattggccgctaaagccagggaaggaaagcttcagccgcacgaattt
caaggtggcaccatcaccgtttcgaatcttggcatgttcggcattaagagcttctcggct
atcatcaatcctccacaatccataattctagcgataggaacgacagaaacaagattagtc
ccagcggataacgagaaaggtttcactactgcccagtatatgtgtgtaactgccagctgc
gaccatcgtacagtcgatggagcagtcggagctcaatggcttactgcttttaagaacttt
atggagaacccaacaacgatgcttctctaa

DBGET integrated database retrieval system