KEGG   Nasonia vitripennis (jewel wasp): 100122952Help
Entry
100122952         CDS       T01081                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100122952
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100122952
   00020 Citrate cycle (TCA cycle)
    100122952
   00620 Pyruvate metabolism
    100122952
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100122952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 604 aa AA seqDB search
MSDNDSEVEESVCVPAELCETVEVATLDALPTKSKSTYEGCYKTFSEWKHSSDIQESTES
VMLTYFTNLSQSYKPSTLWAHYSMLKTTMRVFENTDIGTYRNLVDFIKKQAQGYQSQKSK
TLTTEDVKRFLTEAPDDRYLLTKVVLICGIAGACRKDELTNMKIQHIESHGNLFLVKIPG
SDTSKARSFTVTDEFYKIVKRYLDLRPSSVPSDRFFLAYKNGKCSQQPVGKNKLGSMAKE
VATYLNLPDANQYTGHCFRRTSASVLIDSGANMTAVTCKRKRCPEAKPTFTQVYIKEEIN
DADTDYIQEYIKKELQNESEQDPFEEPEDKKQKLEDAENGLKGSGLFGSVTAKDLAGASP
AGVGAPAGAAVAAPGGKDIPISNVRGVIAKRLLESKQTIPHYYLTIEVKMDEALSMRQQF
NKLLEKEKIKLSVNDLIIKGMAMACKKVPEGNSAWLGDKIRQYDHVDVSVAVSTDNGLIT
PIVFGADVKGIVQISNDVKALAAKAREGKLQPHEFQGGTITVSNLGMFGIKSFSAIINPP
QSIILAIGTTETRLVPADNEKGFTTAQYMCVTASCDHRTVDGAVGAQWLTAFKNFMENPT
TMLL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataacgattccgaggttgaggagagcgtttgcgtgccggccgaactttgcgag
acagtggaagttgctacgctagatgccttaccgacaaaatcgaaaagcacttacgaaggt
tgttacaaaaccttttcagaatggaagcactcgtccgacatccaagaatccacggaaagc
gtcatgttgacttattttaccaatctatctcaatcgtacaagccgtcgactctgtgggcg
cactactcgatgctcaagactactatgcgcgtcttcgaaaacactgacattggcacttat
cgtaatttagtcgactttataaagaaacaagcgcaaggctatcagagtcaaaagtcgaaa
actttgacgaccgaagatgtgaagagatttttgaccgaagcacccgacgacaggtatctg
ttgaccaaagttgttctaatttgcggaatcgccggagcttgtcgcaaggacgaacttacg
aatatgaaaattcagcacatcgaatctcacggcaatttgttcctcgttaaaattccggga
agtgacacttccaaggcacgatctttcaccgtcaccgacgaattttacaaaattgtaaaa
agatatctggacttacgtccgtcgtctgttccgtcggatagatttttcttggcttacaaa
aacggaaaatgttcgcaacagcctgttggaaaaaacaagcttggctctatggccaaggaa
gttgcgacgtatttaaacttgccagatgctaatcagtatactgggcactgtttccgccgt
acttccgcatcggtactcatcgattcgggagccaatatgacagctgtaacgtgcaagcga
aaacgctgtcctgaggcaaaacctacctttactcaggtttacataaaagaagaaatcaac
gacgcggatactgattatattcaagaatatatcaagaaggaattgcaaaatgaaagcgag
caggatccttttgaagagcctgaagataaaaagcagaagttagaagacgcagaaaacggt
ttgaaaggcagtggcctattcggttcagtgacagccaaggacttggctggtgcttcccct
gctggagttggagcaccagcaggagccgcagtcgccgcacccggtggcaaggatattccc
atttccaacgttcgtggagtcattgccaaacgtctgctggagagcaaacagacgataccc
cattactacctgaccatcgaggtgaaaatggacgaggctctatcgatgaggcaacagttc
aacaaattgcttgagaaagagaagatcaagcttagcgtcaatgaccttatcatcaagggt
atggctatggcgtgcaaaaaagtgccggagggcaacagcgcttggctcggagacaaaatt
cgacagtatgatcacgtagatgttagcgtagctgtcagtacagacaatgggctcataacg
cctatcgtctttggagccgacgtaaaaggcatagttcaaattagcaacgatgtaaaagca
ttggccgctaaagccagggaaggaaagcttcagccgcacgaatttcaaggtggcaccatc
accgtttcgaatcttggcatgttcggcattaagagcttctcggctatcatcaatcctcca
caatccataattctagcgataggaacgacagaaacaagattagtcccagcggataacgag
aaaggtttcactactgcccagtatatgtgtgtaactgccagctgcgaccatcgtacagtc
gatggagcagtcggagctcaatggcttactgcttttaagaactttatggagaacccaaca
acgatgcttctctaa

DBGET integrated database retrieval system