KEGG   Nasonia vitripennis (jewel wasp): 100122982Help
Entry
100122982         CDS       T01081                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00511  Other glycan degradation
nvi00600  Sphingolipid metabolism
nvi01100  Metabolic pathways
nvi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100122982
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100122982
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100122982
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100122982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Alpha-L-AF_C
Motif
Other DBs
NCBI-GeneID: 100122982
NCBI-ProteinID: XP_008202000
NASONIABASE: NV13655
Position
5
AA seq 510 aa AA seqDB search
MSKITWIIVALYCATVIAQDCKPVNFGSDSIVCECNSTYCDNYPDPKPPSEGEFIWYVTS
KSGQRLNRTDGKIDSRPKNGLTVRIDSNKLYQNMEGFGGAFTDSACINIKSLSQETQDNL
MNSYFSTNGSNYNFGRVPIGGSDFSTRPYSYDSTPGDKELKDFSLAKEDTEYKIPLMQKA
RKINPSLRFLSAAWTAPPWMKNRKIFVGFSYLLEEYYQTYADYIVKFLETYKSYGLDMWA
VSAGNEPFNALLLIFSKINNMFWSPGNACKWVINNLGPSIEQSKSNNTIILMLDDNRVAL
PWYMVDVKIWHSEALKYVKGIAVHWYTDTVIPASVLDLTHDLLPDKFILMTEACVGDRPW
VYPKVNLGSWQRAEEIVDKIFENINHHVVGWVDWNLALDLQGGPNWVDNYVDAPIIVDDE
KDVFYKQPMYYVTTHFSKFVPRNSVRVHTNSEDKNVIATAFKTGDYKVIVLLFNKSNKKK
SISIVDEKVGSINVELTENSVHTILYNYDA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagattacttggataattgttgccttgtattgtgctacagtcatcgctcaagac
tgcaaaccagtcaattttggatccgacagtatagtttgcgaatgcaactccacatattgt
gacaactatcccgatcctaaaccaccaagtgaaggcgaattcatatggtatgtcacgagt
aaaagtggacagagacttaatcgcaccgacggaaaaattgatagtcgacctaaaaatgga
ttaacggtccgtatcgattccaataagctgtatcaaaatatggaaggattcggcggtgct
ttcactgactcagcttgtatcaacatcaaaagtcttagtcaagaaactcaagacaattta
atgaattcgtactttagcacgaacggaagcaactacaattttggtcgcgtgcctataggc
gggtcagatttttctacgagaccttattcttatgattctacccccggtgataaagagtta
aaagatttctcacttgccaaagaagacaccgagtataagatcccgcttatgcaaaaggcc
cggaaaattaacccatcccttcgctttttatcagctgcgtggactgcaccaccatggatg
aagaacaggaaaatatttgtaggattcagttatttgttagaagaatattaccaaacttac
gcagattacattgttaagtttttagaaacatataaaagttacggactggacatgtgggct
gtctcagcgggaaatgagccattcaatgcattgttgctcatttttagcaaaataaataac
atgttttggtcaccagggaatgcctgtaaatgggtcatcaacaatttagggcctagcata
gagcaatcgaaaagtaataatacaattatccttatgcttgacgataatagagtagcgcta
ccttggtacatggttgacgtaaaaatttggcatagcgaagctctaaaatacgttaagggt
attgccgtgcactggtatacggatactgttattcctgcaagtgtacttgatttaactcat
gatctcttgccagataagtttattttgatgacagaggcttgcgtaggtgatcgcccatgg
gtttatcccaaagttaatttgggatcgtggcaacgtgcggaagaaatagtagataagatc
tttgagaacataaaccatcatgtagtcggttgggtcgattggaatctggcccttgatctt
caaggagggccaaattgggtagataactacgttgatgccccgataatcgttgatgatgaa
aaagatgtcttttataagcagccaatgtactacgtaacgactcattttagtaaatttgtg
cctcgcaattctgtcagggtacacactaatagtgaagacaagaatgttatagcaacagcg
ttcaagactggcgattataaagtaattgttcttttgttcaacaaaagtaacaaaaagaag
agtatttcgattgtagatgaaaaagttggcagcataaacgtggaattgactgaaaattct
gtacatacaattttgtacaattatgatgcataa

DBGET integrated database retrieval system