KEGG   Nasonia vitripennis (jewel wasp): 100122982Help
Entry
100122982         CDS       T01081                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:nvi00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:nvi00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:nvi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 509 aa AA seqDB search
MSKITWIIVALYCATVIAQDCKPVNFGSDSIVCECNSTYCDNYPDPKPPSEGEFIWYVTS
KSGQRLNRTDGKIDSRPKNGLTVRIDSNKLYQNMEGFGGAFTDSACINIKSLSQETQDNL
MNSYFSTNGSNYNFGRVPIGGSDFSTRPYSYDSTPGDKELKDFSLAKEDTEYKIPLMQKA
RKINPSLRFLSAAWTAPPWMKNRKIFVGFSYLREEYYQTFADYIVKFLEEYQKYGLEMWS
VSTGNEPFTSLVIISRINSMFWSSDTASKWVINNLGPSIEKSKSNNTIILMLDDQRLALP
WYMVDVKVRHSEALKYVKGIGVHWYSDAVIPANVLDLTHDLLPDKFILMTEACIGDRPWD
HPKVILGSWKRAEKLVDKIFENINHYVVGWVDWNLALDIQGGPNWVDNYVDAPIIVDAKK
DVFYKQPMYYVTTHFSKFVPRNSVRVHSDSKDTNVITTAFKTKDNRIIVLLFNKSNQNKS
ISIIDDKYGNINVELPEHSVHTIIYKYDV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagattacttggataattgttgccttgtattgtgctacagtcatcgctcaagac
tgcaaaccagtcaattttggatccgacagtatagtttgcgaatgcaactccacatattgt
gacaactatcccgatcctaaaccaccaagtgaaggcgaattcatatggtatgtcacgagt
aaaagtggacagagacttaatcgcaccgacggaaaaattgatagtcgacctaaaaatgga
ttaacggtccgtatcgattccaataagctgtatcaaaatatggaaggattcggcggtgct
ttcactgactcagcttgtatcaacatcaaaagtcttagtcaagaaactcaagacaattta
atgaattcgtactttagcacgaacggaagcaactacaattttggtcgcgtgcctataggc
gggtcagatttttctacgagaccttattcttatgattctacccccggtgataaagagtta
aaagatttctcacttgccaaagaagacaccgagtataagatcccgcttatgcaaaaggcc
cggaaaattaacccatcccttcgctttttatcagctgcgtggactgcaccaccatggatg
aagaacaggaaaatatttgtaggattcagttacctacgagaagaatactatcaaactttt
gcagattatatcgttaaatttttggaagaataccaaaaatatggactagaaatgtggtcc
gtttcaactggaaacgagccattcacttcgttggttatcatttctcgaatcaatagcatg
ttctggtcatcggacactgcatcaaaatgggtcatcaacaatttaggacctagcatagaa
aaatctaagagtaataacacaattatccttatgcttgacgaccaaagactagcactacct
tggtacatggttgacgtaaaagttaggcatagcgaagctctaaaatacgttaagggtatt
ggtgtgcactggtactcggatgctgttattcctgcaaatgtacttgatttaactcatgat
ctcttgccagataagttcattttgatgacagaagcttgcataggtgatcgcccatgggat
catcctaaagttattttgggatcgtggaaacgtgcggaaaaattagtagataagatcttt
gagaatataaaccactatgtagtcggttgggtcgattggaatctggcccttgatattcaa
ggagggccaaattgggtagataattacgttgatgccccgataatcgtcgatgctaaaaaa
gatgtcttttataagcagccaatgtactacgtaacgactcattttagtaaatttgtgcct
cgtaattccgtcagggtgcacagtgatagtaaagacacgaatgttataacaacggcattt
aagaccaaagataatcggattattgttcttttgttcaataagagcaatcaaaataaaagc
atttcgattatagatgataaatatggtaatataaatgtggaattgccagaacattctgta
catactattatatacaagtacgatgtgtaa

DBGET integrated database retrieval system