KEGG   Nasonia vitripennis (jewel wasp): 100122982Help
Entry
100122982         CDS       T01081                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100122982
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100122982
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100122982
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100122982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 225 aa AA seqDB search
MSKITWIIVALYCATVIAQDCKPVNFGSDSIVCECNSTYCDNYPDPKPPSEGEFIWYVTS
KSGQRLNRTDGKIDSRPKNGLTVRIDSNKLYQNMEGFGGAFTDSACINIKSLSQETQDNL
MNSYFSTNGSNYNFGRVPIGGSDFSTRPYSYDSTPGDKELKDFSLAKEDTEYKIPLMQKA
RKINPSLRFLSAAWTAPPWMKNRKIFVGFKHKPSCSRLGRLESGP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagattacttggataattgttgccttgtattgtgctacagtcatcgctcaagac
tgcaaaccagtcaattttggatccgacagtatagtttgcgaatgcaactccacatattgt
gacaactatcccgatcctaaaccaccaagtgaaggcgaattcatatggtatgtcacgagt
aaaagtggacagagacttaatcgcaccgacggaaaaattgatagtcgacctaaaaatgga
ttaacggtccgtatcgattccaataagctgtatcaaaatatggaaggattcggcggtgct
ttcactgactcagcttgtatcaacatcaaaagtcttagtcaagaaactcaagacaattta
atgaattcgtactttagcacgaacggaagcaactacaattttggtcgcgtgcctataggc
gggtcagatttttctacgagaccttattcttatgattctacccccggtgataaagagtta
aaagatttctcacttgccaaagaagacaccgagtataagatcccgcttatgcaaaaggcc
cggaaaattaacccatcccttcgctttttatcagctgcgtggactgcaccaccatggatg
aagaacaggaaaatatttgtaggattcaaacataaaccatcatgtagtcggttgggtcga
ttggaatctggcccttga

DBGET integrated database retrieval system