KEGG   Nasonia vitripennis (jewel wasp): 100123054Help
Entry
100123054         CDS       T01081                                 

Definition
serine/threonine-protein kinase minibrain-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 706 aa AA seqDB search
MEYGGGGGGGSGAGRGGGVQPPATGARGIVAGTDTTDAAWHKHEQMMIMESRHKQQLSGR
TVTGGAPLYGRLVAEEPLPGAVCGAGGTGGGSGVMPQETPADIHAMQARIPHRFRDPATA
PLRKLSVDLIKTYKHINEVYYAKKKRRAQQMQGEDGSHKKERKLYNDGWDDDNHDYIIKN
GEKFLDRYEIDSLIGKGSFGQVVKAFDHEEQTQVAIKIIKNKKPFLNQAQIEVRLLEMMN
RADTDNKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCT
ALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPE
VLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGMPPKHILDQAHKA
RKYFDKVPTDGSYVLKKSKEGKKYKLPGTRRLHDILGVETGGPGGRRHGEPGHSISDYLK
FKDLILRMLDFDPKTRVTPYYALQHNFFKRTADEGTNTNIAAANSANTSPAVVSMSQDHG
LVSMSGQGSSSGGGGSGSSGSTGSGAQHQPMECESSPRHTLGLGGRRPTGSSNAPTSSAP
ASIDAGSGNGGGSSLIQSSLGSYNSLILPSIPHLPAAMMGSPMSGIHHQQPSFYNYASYG
AGTEGHRQVVVPSQVVVAGAKQRADADREDSPMVGVCVQQSPVAIH
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgggggcggcgggggcggcggcagtggggccggccgcggtggcggtgtccag
ccaccggcgaccggtgccaggggcatcgtcgccggcaccgacactaccgacgccgcgtgg
cacaagcacgagcaaatgatgatcatggagtcgaggcacaagcagcaactgagcgggagg
acggtgacgggaggcgcgcccctgtacggccgactggtggccgaggagccgctgcccggc
gcggtctgcggggccggcggcacgggcggcggctccggggtcatgccgcaggagacgccg
gccgacatccacgcgatgcaggccaggataccccacaggtttcgggacccggccaccgcg
ccgctcaggaagctcagcgtcgaccttatcaagacctacaagcacatcaacgaggtatac
tatgccaaaaagaagagaagggcgcaacagatgcagggcgaagacggctcgcacaagaag
gagagaaagctctacaacgacggttgggacgacgacaaccacgactacattatcaagaat
ggggagaagttcctcgatcggtacgagatcgattcgttaattggtaaaggcagttttggc
caagtggtgaaggcattcgatcacgaagaacaaactcaggtggcaataaaaatcatcaag
aacaaaaaacccttcctaaatcaagcgcaaattgaagttaggttactggagatgatgaat
agagcggataccgataacaagtattatatagttaaactcaagaggcattttatgtggcgg
aaccatctgtgtttggtatttgagctactgtcgtacaacctctacgatttacttagaaat
acgaatttccgaggggtgtcgttgaacctgacgagaaaattcgcacagcaactgtgcact
gccctcctgttcctgtccacgccggaattgaacatcattcactgtgatctgaagcctgaa
aacatcctcctgtgcaatcccaagcgaagcgcaataaaaattgtcgattttggcagttcg
tgtcaacttggacagaggatataccagtacatacagtctaggttttaccgatcacccgaa
gtgttactaggcataccttacgacctcgcgatagacatgtggagtctgggttgtatttta
gtagaaatgcatacaggagaacccttgttcagtggagccaacgaggttgaccaaatgaac
aaaattgtcgaagtgctgggcatgccgccaaagcacatactggaccaagcgcacaaggcg
cggaagtactttgataaagtccccacggacggctcgtacgtactgaaaaaatccaaggaa
ggcaagaaatacaaattgccgggcaccaggcggttgcacgacatcctgggcgtcgagacg
ggcggccccggtggcaggaggcacggcgaacccggccactcgatctccgactacctcaag
ttcaaggacctgatactgaggatgctggacttcgatcccaaaacgcgggtcacgccttac
tacgcgctgcagcacaacttcttcaagaggacggccgacgaggggaccaacacgaatatc
gccgctgccaatagtgccaacaccagtccggcggtcgtgtcgatgagccaggaccacgga
ctggttagcatgtctggacagggcagtagcagcggcggaggcggtagcggtagcagcggc
agcaccggcagcggcgcgcagcaccagccgatggagtgcgagtcgtcaccgcgacacacg
ctgggcctaggaggcagacggccaacgggcagctcgaacgcgccgacgagctcggcgccg
gcctccattgacgccggcagtggcaacggcggcggcagctccctcatacaaagctctctc
ggctcgtacaacagcctgattcttcctagcattccccacctgcccgcggcgatgatgggc
tcgccgatgagcggtatccaccaccagcagccgagtttctacaactacgcgagctacggt
gccggtactgagggccaccgccaggtggtagtgccctcgcaggtagtcgtcgccggggcc
aagcaacgcgctgatgccgatcgcgaggacagcccgatggtgggtgtctgcgtgcagcag
agccctgtcgcaatccactga

DBGET integrated database retrieval system