KEGG   Nasonia vitripennis (jewel wasp): 100123097Help
Entry
100123097         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase 31-like
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100123097
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100123097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 979 aa AA seqDB search
MSPATGTTLLVSSSDGGVSAQGNNLLDVDQSVVKSVSEGELGVEQESYNQDTQTMSSAVG
VVQSNNATTTLEINSSARKSNLKRAFTLPLHMLQSSKRRPKHLSQRELIKDTEQPIMDQG
RLSAGSKRPSWTKQIIKACKKFVNINTQGHKGASRDDIGSSAGDIRVPPSRPPNIPPDRV
PGVIGLRNHGNTCFMNAVLQCLSHTDRLAKYFVMDTYKDDLSKNKKLNSKKFGTKGEITE
QLALLLKAIWSCQYDPEMSTAFKSVVDKYGSQYRGNLQHDAQEFLLWLLDKVHEDLNQAT
NKKYKIIKNSFGQPESVAEETFANHVRCNKSFVHEVFQAQFRSSLTCPRCQMQSNTFDPF
LCVSVPVPQSQRQMSLFVNVLYTSQQPRQVRIGVSVNQSANVKELREILASDTRVDENHM
LLTEVHDEGFHRTFSDCQPLSVITENDPLYCIELPQLKEPTEQAYILLVWINVLVKGDLR
ERFGSPYTMQVSRETSYEDLQKLLLKEMHATLADDVLTSSQSPGLFNIRVADPAATPVQD
EHPCIDPCVEHPLYTEQIEQALALCADDSGPQHVKLILEWDEATKCNIIQDDTDQIEEHA
SVKQLKSTSEFGGTVTLEECFDLYTRAETLGVEDAWHCPHCNRKQEVVKKLGLWSLPAIL
VIHLKRFRQQSKQRSTSKLTMLVDFPLYGFDMTPHLARNGVQAQQLSQVTTTTVGIGWPT
FKKHTSKQQPVTNYDNNVYDLYAICNHHGQDLQGGHYTAFCRNPYDSQWYSFDDTRVEAV
NDTNLVTNAAYILFYQKRGLTNNPSSGNSSAASTSSAGSGIDHWVSKMPPFYFNKNGSTA
TVSAPANNGNNNNNNNNMSNKQSKSQEALNQERVIEEKNLNNFNRGGRNYSTLQPVKRNA
TADLEDVDVTALNSVVGDEYEDEETPTRIEWTSPKPLRKTSSITLTPHVSVSSSPPAIIQ
NGTLSSSDQESAVIHESTL
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggccaccgggacgacgctgctggtaagcagcagcgacggcggtgtttcagcc
cagggtaataacctgctcgacgtcgatcagagcgtcgtcaagtccgtctccgagggtgag
ttgggcgttgagcaggagagctataaccaggacacccaaacaatgagcagtgctgtggga
gtagtgcagagtaacaatgctacgactactctggagattaattcatctgcaagaaaaagc
aatctgaaaagagccttcacattacctttacatatgttgcaatcgtccaagagacgacct
aagcacctaagccaacgagagctgataaaggacacagagcagcctatcatggaccagggt
aggctatccgcagggagtaagagaccctcctggaccaagcaaattattaaggcatgcaag
aagttcgtgaacatcaatacccagggccacaagggtgccagtagagacgacattggatcc
agtgcgggtgacataagggtaccgccaagcaggccacccaatatacctccagaccgagtt
cccggtgtcattggcctgaggaaccatggcaatacgtgcttcatgaacgcagtgttacag
tgtttgtcccacacggaccgtttggccaagtactttgtgatggacacttacaaggatgat
ctgtcgaaaaataaaaagttaaactccaagaagtttggcaccaagggagagataacggaa
cagcttgctctgttgctgaaggcaatatggagctgtcagtatgaccccgagatgagcact
gcctttaagagtgtcgtggacaagtatggaagccagtaccggggcaatctgcagcacgac
gcccaagaattcttactgtggctgctggacaaagtacacgaggacctcaatcaagcgacc
aacaaaaagtacaagatcataaagaattcgttcggccagccggaatcggtggcggaggaa
accttcgcgaatcacgtgcgctgcaacaagtctttcgtgcacgaggtcttccaggcgcag
tttcgctcgagcctgacctgtccgcgctgccagatgcagtccaacacgttcgacccgttc
ctctgcgtctcggtgccggtgccccagagccagcgccagatgagcctcttcgtcaacgtg
ctctacacctcgcagcagcctcgacaggttcgcatcggtgtcagcgtcaaccagtcggcc
aacgtcaaggagctcagggagatactggccagcgatacgcgcgtggacgagaaccacatg
ctgctgaccgaagttcacgacgagggctttcatagaacgttctcggactgccagccgctg
tcggtgataacggagaacgacccgctctactgcatcgagctgccacagttgaaagagccc
acggagcaagcctacatactcctggtctggatcaacgtgttggtcaagggtgacctgcgc
gagcgcttcggcagcccttacacgatgcaggtgtcccgcgagacgtcgtacgaggacctg
cagaagctgctgctcaaagagatgcacgctaccctcgccgacgacgtgctgacatcctcc
cagagccctgggctcttcaacatccgagtggctgaccccgcggcaactcccgttcaggat
gagcatccgtgcatcgacccgtgcgtcgaacatcctctgtataccgagcagatcgagcag
gcgttagctctctgcgcggatgactctggaccgcagcacgtgaagctcatcctggagtgg
gacgaggctaccaagtgtaatatcatccaggatgacaccgatcagatcgaggagcacgcg
agcgttaagcagttgaagagcacctcggagtttggcggtacagtgaccctggaagagtgc
ttcgacctgtacaccagagcagaaaccctgggcgtcgaggatgcctggcactgtccacac
tgcaacagaaaacaagaagtcgtgaagaagcttggcctctggtcgctacccgccattctg
gtgatacacttgaagaggttcagacaacaatcaaaacaacgctcgacgtccaaactgacc
atgttggtggattttcctctctacgggttcgacatgacgcctcatctggcccgcaacggt
gtccaggcgcagcagctctcgcaggtgacgacgacgacggttggcattggctggcccacc
tttaaaaagcatacatccaagcagcaacccgttaccaattacgataataacgtgtatgac
ctctatgccatctgcaaccaccacggacaggatctgcagggtggacactacacagcgttt
tgccgtaatccctacgacagccagtggtactctttcgacgacacgcgagtcgaagcggtt
aacgacacgaatctagtgacgaacgcagcctatatactgttctaccagaagcgcggttta
acgaacaacccctcttccggtaactcgtcagcggcctcgacgtcatccgctggttctggc
atcgaccactgggtctccaagatgccgcctttctatttcaataagaacggctcgactgcc
accgtctcggcccccgcaaacaacggcaataacaataacaacaataacaacatgagcaac
aagcagagcaagtcgcaggaagcgctgaaccaggagagggtcatcgaggagaagaacttg
aacaatttcaacagaggtggcaggaactattcgaccttgcagccagtaaaacgcaacgct
acggcggacctagaagatgtggacgtgactgcgttaaattcagtggtaggtgacgagtat
gaggacgaagaaactcctactaggatcgaatggacatcgccgaagccgctgagaaaaacg
tcttcgatcacgttgacgccccacgtgagcgtgtcgtcgtcgccgcctgcgataatccag
aacggcacgctgagcagcagcgatcaagagtctgctgtgatccacgaatcgacgttgtaa

DBGET integrated database retrieval system