KEGG   Nasonia vitripennis (jewel wasp): 100123115Help
Entry
100123115         CDS       T01081                                 

Gene name
Set2
Definition
histone-lysine N-methyltransferase SETD2
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100123115 (Set2)
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100123115 (Set2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 1778 aa AA seqDB search
MARRRKVEAKASPKPQPVASAVRKSTRQRAKKQLEEQKVNGDVSTNVGNSEDCKDPNEDS
QEPVKKVNAVPKKSGRHKNLVEKTKPTTESGNSQSQEGESDNSQDDQGAEQIPIEKLDTV
EVEEQVTATENTLDQVVWSEDVIEETIICEEMEVETEMTDGCSIAQDGSVVVEQVILMND
DPNFEEKDVVEYTVIQNEDGTESMIVSSENMENVETLNESYRTLNNCQMIEQGLSVLHVS
EAVAEVAEPEVESKSEVVTENDKSIQPLCDSDTSETVKMDENEPKKEYRSLRSVTRGVKS
TRTRKSAATADETVKNESDGRRRKTDSKKAASTEAKSSSVGGKEKSIKSRRANVQVSTSV
IEQNNTQNSTDLLQKSVTLSQEDDNSSSMSDKIEHQETSDVSTSDYLKDNKNVNNSIISE
QASISPPPDLKIEIANRLPAKSKNVLFGNEEHSRDSEMDGKIDSEDTKISSSSENSNDTL
LSSHSCKNSDSNMDNKSALNQANDTAEKKPGFRSRSGSTDTTGSESGSNSSGVRRSNRIR
TIGLMKQRSRGRGLVTKPSVDPTKTAIQQDRDKLASNTPPILDKDNNQGKDVLETILETQ
SDKENSSNKTTTAQDVLTPLISATGTTGYDSDSNKPVKVKSRWRRSSELEMSNSGWSASR
PALGFPNPTVTGTPIGTVSNTLSDTINKLPPLPVGLPQESKTTTDIQDSVSVVPSQNSLD
ICSSSDSSIVANSSSTSAAVSTLIPKAVGARISLPNVPVVADREMEERLSQFEHLKENLY
LTERFTSKETKRMVCECFLTEEEFQRGELGCGEDCLNRLLMIECGSRCVVGDRCTNKRFQ
NCEYANCEVFRTEKKGFGLRATTNLEAGDFIMEYVGEVLDPKDFRKRAKEYSKDKNRHYY
FMALKSDQIIDATMKGNISRFINHSCDPNAETQKWTVNGELRIGFFNKKFVAAGEEITFD
YHFQRYGKEAQKCFCEATNCRGWIGDKPEDNKKSSLAEEMEDTSSSSESDVEDAEDNKEE
EEDVDKPETPVKPVRRRRRKRVEKKVTEHMEDEDLEEQIDKLCASGLKNRAHTLTLSRLM
VRSREIQHRTRLLKVIRFGEQACRRLFLDYHGLRLMWGYMMDVAGSSTDEVQQFRLEILK
TLSTLPIPNRSMLIDSKVLSVIEKWSKQLYQSSGESPEDDQSKPKSSNEETEMDTSKKPN
AESETNVVKKESELEIKCEGNAQVLDPTLISELANNLLVSWSNLKEVFRIPKKERIEQMK
EHEREADRGYKEDVEKEARESSSYERHRSDRYSRNELEKRPDRRRGRDSPDFEHSRAKDK
RTLEERPNLVQVPRLSKFERRQLFAMKVAKEEEERQRRQQEESWQQHQAQCIALGLDPYA
TPAFDPQTGYHLFFNPQLSQWQPYPSIQEGAAEIAQQVTPVYMGPGGSVVASPAGAIVGT
PQPPLYPIGQPPPPYGTPLIQLGPGNLIPMPNGTAPLYVEKLPEPESEQQIPVVLAEPEP
EVEATPVPPPPLDLPPKWKWARDKRGRVYYYHVKERVSQWLPPPPDHIAVQPDSSTTSES
SDESSSSNEEEDDVEEQLDQTAEGMEVDASEVAVAIPQPEGKKRRDGLVQERIISPRREE
DRVDHKKYKEIKEKLRRQKERAKLKEHFEKMKKHRRSSKSKSHAKHASSKFQPITSDMSP
TTERRIKDTFRINMANVMVHFLNPYRKSDCKQGRITNTDDFKHLARKLTHFVLAKELKHC
KSVDELECNDNVKHKAKDFVRKYMSKFGAVYQKGTDED
NT seq 5337 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcggcgaaaagtagaggctaaagcctctccgaaaccacagccagtggcttct
gctgtaaggaagtcaactagacaaagggcaaaaaagcaattggaggagcagaaagtcaat
ggggatgtatccacaaacgttggtaattctgaagattgcaaggatcctaatgaagatagt
caagagcctgttaaaaaagtcaatgcagttcctaaaaagtcaggcagacacaaaaattta
gttgaaaaaactaagcctacaacagagagtgggaatagtcaaagtcaagaaggagagagc
gataatagtcaggatgatcaaggagctgaacagatcccaattgaaaaattggacaccgtt
gaggttgaagaacaagttactgccactgaaaatacgttagaccaagttgtttggtccgaa
gatgttatagaagagactatcatttgtgaagaaatggaagtcgaaaccgaaatgaccgat
ggatgttctatagcacaagatggcagtgttgtggtcgagcaggtaatactcatgaatgat
gatcctaattttgaggaaaaagatgtggtggaatatactgtaattcaaaatgaagatggc
acagagtctatgatagtttcatcggaaaatatggaaaatgtagaaactttaaatgaaagt
tatagaactctgaataattgtcaaatgatagaacaaggtctcagtgtcttgcatgtgtct
gaagcagtagcagaagtagctgaacctgaagtggaatctaaaagtgaagtggttacggag
aatgataaaagtattcaaccattatgtgattccgatactagtgaaactgtgaaaatggat
gaaaatgaacctaaaaaggaatatcgatctttaagaagtgtgactagaggtgtcaaaagt
accagaactagaaagtcagctgctacagctgatgaaactgttaaaaatgagagtgatggt
agaaggcgaaagacagatagtaaaaaagcagcttctacagaagccaagtcatcaagtgta
gggggtaaagaaaagtcaataaaatctagaagagctaatgttcaagtatccactagtgta
attgaacaaaataatactcaaaattcaacagatttattacaaaaatctgtgacattgagt
caggaggatgataatagttcatcgatgtctgataaaatagaacaccaagagacatccgat
gtttctacatctgattatttaaaagataataaaaatgtaaataatagtataatttcggaa
caagcaagtatttcaccacctccagatttaaaaatcgagattgcaaatcgtttgcctgca
aaatcgaaaaatgtactatttggtaatgaagagcattctagagatagtgaaatggatgga
aaaatagactctgaagatactaaaatttcaagtagtagcgaaaacagcaatgatactctc
ttatcatctcatagctgcaaaaattcagattctaacatggacaacaaaagcgcattaaat
caagccaatgatactgctgaaaagaaaccaggttttagaagtcgcagtggaagtacagat
acaacagggtcagaaagtggatctaatagctctggtgttcgtcgcagtaatagaatcaga
accataggattgatgaaacaaagatctcgtggccgtggtttagttacaaaaccatctgtg
gatccaactaaaacagctattcaacaagatcgtgataagctggcaagtaatacaccacca
attctggataaagataataatcaaggtaaagatgttctggagactatacttgaaacgcaa
tcagacaaggaaaacagtagcaataaaacgacgactgctcaggacgttcttacgccgttg
atatctgccacagggacaacgggatatgattctgattcgaataagcctgttaaggttaaa
tcgcgctggcgtcgatctagtgagttagaaatgagcaattcaggatggtctgcatcacga
ccggctttaggttttcctaatcccacagtgacaggaactccgatcggaactgtgtctaat
acgttaagtgatacaattaataaattaccgcctttacctgtagggttaccgcaagaatcg
aaaacaacgacggacattcaagattcggtatcggttgttccttcgcaaaacagtttagat
atttgtagtagcagtgacagttcgatagttgcgaatagttcgtcaactagtgctgctgtc
tcgacgctcatcccaaaagctgtaggagctagaatttctttacctaatgttcctgtagtt
gctgacagagaaatggaggagagattaagtcaattcgaacatttgaaagaaaatttgtat
ttaactgagcgattcacaagcaaagaaacaaaacgaatggtatgtgaatgctttttaaca
gaagaagagtttcaaagaggagagcttggttgtggggaagattgcctgaataggctttta
atgattgaatgtggatcaagatgcgtggtcggcgatagatgcacgaataaacgatttcag
aattgtgaatatgctaattgtgaagttttcagaacagaaaagaaaggtttcggtttaaga
gctacaactaatcttgaagcgggtgactttataatggaatacgtcggtgaagtacttgat
ccaaaagattttagaaaacgagcaaaagaatattctaaagacaaaaacagacactactat
tttatggcactcaaatctgatcaaattattgacgcgacaatgaagggaaatatttcccgt
tttattaatcacagttgtgatccgaacgctgagactcaaaagtggactgttaatggggaa
ttgagaattggattttttaataaaaaattcgttgctgctggagaagaaatcactttcgat
tatcattttcaacgatatggaaaagaggcacaaaaatgcttttgcgaagcaaccaattgt
cgcggttggattggtgataaaccagaagataataagaaatcatctttagcggaagaaatg
gaagatacgtcaagttcttcagaaagtgatgttgaagatgcagaagataacaaagaagaa
gaagaagacgtcgataaaccagaaacgcctgtaaaacccgtaaggagaagaagaagaaag
cgagtggagaaaaaagtcacagaacacatggaagatgaagatttggaagagcaaattgat
aaattgtgcgcaagcggcctgaagaatcgcgctcacacgttaactctcagtcgtttgatg
gttcgtagcagggagatccaacacagaacgcgtcttctgaaggtgatacgattcggagag
caagcatgtcgcagattattcttagactatcatggcttacggttgatgtggggttacatg
atggatgtagctggaagctcaaccgacgaagttcaacaatttagactggagattttaaaa
actcttagtacactgccaattcctaataggagtatgctaatcgacagcaaagttcttagc
gttatagaaaaatggtcgaaacagctgtatcaatcaagcggcgagtcacccgaagatgat
cagtccaagcccaagtccagtaatgaagaaactgaaatggatactagcaagaaacctaac
gcagaaagcgaaactaatgtcgtgaaaaaggaatccgagttggagatcaaatgcgaaggc
aatgcacaagttcttgatccaacgctcatttccgagttggcgaacaatttgttagtcagt
tggtctaacttaaaagaagtttttagaataccaaagaaagaacgtattgagcaaatgaaa
gagcacgaaagagaagcagatcgtggatataaagaagacgtagaaaaagaagcaagagaa
tctagttcatacgaaagacacagatctgatagatatagtcgcaatgaattagaaaagcgt
ccagatagaagaagaggtagagactcgcccgatttcgagcatagccgagccaaggataag
agaacgctggaggaacgaccaaaccttgtgcaagttccacgtctgtcaaaattcgaacga
agacaattatttgctatgaaggtagcaaaagaggaagaagaacgacagcgacgtcaacaa
gaagaatcgtggcagcagcatcaagcacaatgcatagctctaggtttggatccttatgca
actcctgcttttgatcctcaaacgggctatcatttattcttcaatcctcagttgagccaa
tggcaaccttatccctccattcaagaaggtgctgcagaaattgctcagcaggttactcct
gtttacatgggaccaggcggttctgtggtagcatcaccagcaggagcaatagtcggtact
cctcagccacctctatatccaataggccaacctccacctccttatggtactccgctgata
cagctgggtccaggcaatctcataccgatgcctaatggcactgcaccattgtatgttgaa
aagttgccagagccggagtccgaacagcagataccagttgtgttggcggaacctgagcct
gaagtagaggctacccctgtcccgccaccgcctttagatctgccgcccaaatggaagtgg
gcgcgggataagcgcggtagagtttattattatcacgtgaaggagagagtgtcacagtgg
ttaccgccgccaccggatcacattgccgtccaaccggattcctcgacaacgtccgaatca
agcgacgagtcgagttcctccaacgaagaagaggatgatgtcgaagagcagctggatcag
acagccgagggcatggaggtagacgcgtctgaagtcgctgtggcgatacctcaaccagag
ggcaagaaacgaagagacgggctcgttcaggagaggattattagtccccgaagagaagaa
gatcgcgtcgatcataagaagtataaagaaattaaggagaaattaagaagacaaaaggaa
agggctaaattaaaggaacatttcgaaaaaatgaaaaaacatagacgaagtagtaaatcc
aagtctcacgcgaaacacgccagcagcaaatttcaaccaatcacgtcggacatgtctcct
acgacggaaagaagaatcaaagatacgtttagaattaacatggcaaatgtgatggtacat
ttcttgaatccatacagaaaaagtgactgcaagcaaggtaggatcaccaataccgacgac
tttaagcatcttgcgcgcaagctgacgcatttcgttctcgcaaaagaactgaagcactgt
aaaagtgtcgatgaattggagtgcaatgacaatgtaaaacataaggctaaggactttgtt
cgaaaatacatgagtaagtttggtgcagtgtaccagaaaggtacagatgaagactag

DBGET integrated database retrieval system