KEGG   Nasonia vitripennis (jewel wasp): 100123129Help
Entry
100123129         CDS       T01081                                 

Gene name
CDC27
Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100123129 (CDC27)
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100123129 (CDC27)
Ubiquitin system [BR:nvi04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100123129 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 830 aa AA seqDB search
MIVQEPVQAAIWHCLNHYAYPDAIFLAERLFAEVDNEETLFLLATSYYRAGKVRQAQALL
SKRSLTSPQCKFLLAKCCYDLGMYAEAEAAIVGGYYKQVKNFDEIVTQFGDEACFSLQII
AKICYKMTRTTKGNEAHRLALKLNPFLWHSFEEVCNTGEKIDAKKIFQLDKLDNLSTCIG
STPVSYYTPEPDLIVSSNNAPITPTTNNVQITPNQGTNGLPNNVRLHSSIEESPQNISNH
MNTCSTMSPRGKPPRYRSMFSSSMSPLTPSFGILPLDINTPEPPAISTHATLTEANDQKS
LAKRQLISRKETPLQQGKLVFSQSGNTSNTANIVTVTPATPVPPQPTLQGPNVRRSSRLF
SHSYSVKENNKSPNRNKFTTPKSPSRKTKTRLSKSNLNKANYNDLNEKNRNEKEKSETIT
SEKVVANTNALNQSNNSTFTSPVTIQKHSAEGLMSLLRKLGEAYNYLCQFKCVDAVEILS
VLPRHHYNTGWVLSMLAKAHFEMIDYKKAANHFAQVRTLEPHRTELMEIYSTVLWHLHAE
VQLSTLAQDLVAEDRNSPAAWCATGNLFSAQTEHETAIKFFQRAIQVNPNFPYAYTLLGH
EYVITEELDKAITAFRNAIRLDPRHYNAWFGLGTIFSKQEQYSLAELHFKRALHINPHNS
AIMCHIGVVQHALKKVDQALNTLNRAIQDDPDNTLCKFHRASINFSIGRNAEALSEFEEL
KNIVPKESLVYYSIGKIHKKLGNTHLALMYFSWATDLDPKGVNSQIKEAILSPGQGEDES
FVAQSAEEQTLNSSTEQEGEASGEASGEGSAVVANVTADAQADDSDDSSL
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtccaggagccagtccaggcggccatatggcactgcttgaaccactatgcttac
ccagacgcgatattcctggcagaaagattgttcgccgaagtggataacgaagaaacactg
tttcttcttgctacaagctattacagggctggaaaagtgaggcaggcacaagctttgctc
tcaaagcgctcactgacttccccgcagtgcaaattcctgctggcaaagtgctgctatgac
ttgggaatgtatgcagaagcagaggctgccattgttggaggatactacaagcaggtcaaa
aatttcgacgagattgtcacccagtttggagatgaagcttgcttctcgcttcagatcata
gccaagatatgttataaaatgacaaggaccacaaagggaaatgaagctcacaggttggct
ctgaaactcaatccatttttgtggcactcctttgaggaggtgtgcaacactggtgaaaaa
attgacgcaaagaagatattccagctggataagttagataatctatccacatgcattgga
agcaccccagtctcttactatacacctgaaccagatctcattgtatctagcaataatgct
ccgattactccaacaaccaacaatgtccagataacgccaaatcaaggaacaaatggtcta
cctaacaatgttaggctgcactcatcgatagaagagagtccacaaaacatatctaatcac
atgaatacctgttccaccatgtcccctcgtgggaagccacctcgctacagaagcatgttc
agcagctcaatgagtcctttaacgccgagtttcggaatcctgcctttggacatcaacact
ccagagcctccagctatatccacccatgcaacattgacagaagcaaacgatcaaaaaagc
ttggctaaacgccaattgatatcaaggaaagaaacaccactgcaacaaggaaaattggta
ttttcacaatctggtaataccagtaatacagcaaatattgtcacagttactccagcaact
cccgttcctcctcaaccgacgcttcaaggtcctaatgtcaggagatcgtcaaggctgttt
agtcacagctactctgtaaaagaaaacaataaatctccaaacaggaacaaattcacgact
ccgaaatctccttctcgcaaaactaaaacaagactgtcgaaaagtaatctcaataaggca
aattataatgacttgaacgagaaaaatcgaaatgagaaagaaaaaagtgaaacgatcact
tcagagaaggttgtagcaaataccaatgctttaaatcaaagtaataattcaacattcacc
agtcctgtaaccattcaaaagcattcagcagagggtttaatgtctctgttgcgaaaactt
ggagaagcatacaattacttgtgtcaatttaaatgtgtggatgctgttgagatattgtct
gtattgccaagacaccattataatactggctgggtgttgtctatgctagctaaagcacat
ttcgaaatgatagattataaaaaagcagcaaatcattttgcacaagttaggacattagaa
cctcataggactgaattaatggaaatatatagtactgtattgtggcatttacatgctgaa
gtacagctttctacgttagctcaagacttagtagcagaagatcgaaattctccagctgcc
tggtgtgcaactggtaacttgttttctgctcaaactgaacacgagactgctatcaaattc
tttcaaagagctattcaagttaatcccaatttcccttatgcatatactcttcttggacac
gaatatgtaattactgaggaattggataaagctattacagcttttagaaatgctataagg
ctagaccctcgtcattataacgcctggtttggactaggaaccattttctcaaaacaagaa
cagtatagcttagcagagttgcactttaagagggcattacatataaatcctcacaactct
gcaatcatgtgccacataggtgttgttcaacacgctttaaagaaagtcgaccaagcttta
aatacattaaatcgagcaatccaagatgaccctgacaatactctttgtaaattccatcgc
gcgagtattaatttctcaattggtagaaatgcagaggctctcagtgagttcgaagaactg
aaaaatatcgtacccaaagagtcactagtctattattctataggaaaaattcataaaaaa
ttaggcaacactcatcttgcattgatgtacttcagttgggctacagatttagaccctaaa
ggcgtcaatagccaaataaaagaagctattcttagccctggacaaggtgaagatgaatct
ttcgtagctcagtcagcagaagagcaaacgctcaatagttccacagagcaagaaggagaa
gcaagcggcgaagcaagtggtgaaggcagcgctgtcgttgccaatgtgacggctgatgct
caggcagacgatagcgacgatagtagtttatga

DBGET integrated database retrieval system