KEGG   Nasonia vitripennis (jewel wasp): 100123172Help
Entry
100123172         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase calypso-like
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100123172
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100123172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 625 aa AA seqDB search
MPVDINRLTEGWLELESDPGLFTLLLEDFGVKGVQVEEIYDLQKSLEGPVYGFIFLFRWI
EERRSRRKVVEQDESFVKDEDVVNNIFFAQQVVPNSCATHALLSVLLNCPSIHLGTTLSR
LKVHTTGMCPENKGWAIGNTPELACAHNSHAMPQAKRRQEKNTAGVSTGRFTGEAFHFVS
YVPINGRLFELDGLKPYPVDHGPWEEHEEWTEQFRRVITDRLGISTGEQLQDIRFNLMAV
VPDRRLAISHKLTMLKTNRQIVLEALQQLVKLTNQTNSENHNNKNNSSNNSISNNSNSTD
NEKSEKSNEKKEKTEDENSTVVKNETEGTNPIPVISVERCNDTTNENEEASNSNAKPSTS
GIEKVVNVTALDYATPLQIQTSPAHSSSSTDTSSEIGSAFNSPTQAWGWNSGQISPTSTK
DFKKFVVIRVAGDEKNDNSLSRSLNNININGKRLVTDNNQLNKKVCLSGEVRIPHARVKT
SNGDTVTEEKKVEKIDPKLCSKYPELFEPHTFAPKDLLALLKNLEHEIGICETALKDEND
KRNKYKIDDCRRTHNYDEFICTFLSMLAQQGKLAELIQQHLQLKKQPTVSVSRVHSRTSK
KTESSKCASSAPRRRKGRTKCKRRK
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgatattaatcgcttgactgagggttggctggaacttgaaagtgatccaggt
ttatttaccctccttttggaagattttggagtgaaaggagttcaagtagaagagatttat
gatttacaaaaatctcttgaaggtcctgtctatggctttatatttctatttcgatggata
gaagagagacggtctcgacgtaaagttgttgaacaggatgaaagctttgtcaaagatgaa
gatgttgtcaacaacatattctttgcacaacaggttgtcccaaacagttgtgcaacccat
gcattactttctgttttacttaactgtcccagtattcatttgggtacgacattgtctcgt
ctaaaggtacatacaactggaatgtgtccagaaaacaagggctgggccattggaaacaca
ccagagttagcatgtgctcacaactcccatgcaatgcctcaagcaaaaaggcgtcaagaa
aaaaacacagcaggtgtatctactggtagattcactggtgaagcctttcattttgttagt
tatgtacctattaatggtcgactttttgaattggatggtcttaagccctaccctgtagat
catggcccatgggaagagcatgaagaatggacagagcagttcagaagagtcataactgat
cgtttgggaatatcaacgggagaacagttacaagatataaggtttaatttaatggctgtt
gtaccagatagaagacttgctatctctcataaattaacaatgttgaagacaaacagacaa
atagttctagaagctttacaacaacttgtcaagctaacaaatcaaacaaactcagaaaat
cataataataaaaataatagtagtaataatagtattagtaataatagtaatagtactgac
aatgaaaagtcagaaaaatcaaatgaaaaaaaagaaaagactgaagatgaaaatagcact
gtagtaaaaaatgaaactgaaggtacaaatcccatacccgtcattagtgtagaaagatgc
aatgacacgacaaatgaaaatgaagaggcttccaattctaatgcaaaaccatcgacaagt
ggcattgaaaaagtagtcaacgttacagctcttgattatgcgactcctcttcagatccaa
acatcaccagctcatagttcatcaagcactgacacatcatctgaaataggttctgctttc
aattcaccaacgcaagcatggggatggaattcaggacaaattagccctacatctacaaaa
gatttcaaaaaattcgttgtgatcagagtggcaggggatgaaaaaaatgataacagcttg
agtcgttccttgaataatattaatattaatggcaaaaggcttgtaaccgataataatcaa
ttgaacaagaaagtctgtttgtctggtgaagtgaggattccacatgcaagagtaaaaact
agtaacggagatacagttactgaagagaaaaaagttgaaaagattgatcccaaactttgt
tctaaatatccagaactttttgaaccgcatacttttgctccaaaagatttattagcatta
ttgaaaaatttagaacacgaaatcggtatctgcgagactgctttaaaagacgaaaacgat
aaacgcaacaaatacaagattgacgactgcagaaggactcacaattatgacgaattcatc
tgtacatttttatccatgttagcacaacaggggaaattagctgagctaatacaacagcat
ttgcaactgaagaaacagcctactgtgtcagtcagtagagtacacagtagaacgtcaaag
aaaaccgagtcatctaaatgtgcatcttcagcacctagaagacgaaagggaagaacaaaa
tgcaaaagacgaaagtaa

DBGET integrated database retrieval system