KEGG   Nasonia vitripennis (jewel wasp): 100123187Help
Entry
100123187         CDS       T01081                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100123187
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100123187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 732 aa AA seqDB search
MNWLIILVDYLKYLLDYGTVGRQATMRKISEMSQPIDCKCAEDEEEVSGSCSCSGKSANG
SATASPSSCSATPSAILEEIFYISSKRSTLYRVRLTERGLSLRKESNCGPSKTETILVED
IVGCRCMRSKRRSAGSCACGPGASRGQPHLVESTELVQPHDEYDTSAYLYIYAYTLKRAK
VANKGARRRERTTVTLRFRSFDRYEDNLREASRWRLAIKCLLNRLPVPKAYMSPAHRNLQ
SLLSACPDESKNLLVILNPKSGPGRGRENFQRRVNPILSEAELPYDVYITRHPNYARDFV
RSRDLSQWSGLVLVGGDGIVFEAINGLLQRPDWDTVMKQLPIAVIPCGSGNGLAKSIAFS
KQEPFDQNPMLISALSVVRRRLNQMDLVRVETRKQILYSFLSVGWGLLADVDIESERLRA
IGAQRFTLWSLARLIGLRTYKGSVSYLPCDSPSTGIGAQSNGVVKSNGELARMQEDAKIT
HSKSYGDELDRYTSEIRESKSYDGVFDDVEDELHDVAEDEVDFGGVITDALTLETETVSP
SSATPNTTFTGRRRCDSFYSAKSRKSAYFSTGSGSISSTYHSVEDVNNPNNVDGDGRSKI
IYGPPSSLPALTTKVPSSWTKIEGEFVMVQAAYQTHLGQDCYFAPRAKIADGIIWLLIIR
AGISRTNLLQFMLGFSTGTHLSTPGVEMIPVRAFRIEPAEDTNGLLTVDGEKVDYGPLQG
EIFPSLATVMCP
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaattggctgataattttagtggattatctgaaatacttgttggactatggcaccgtc
ggaagacaagcgacgatgcgcaagatctcggagatgtcgcagcccatcgactgcaagtgc
gccgaggacgaggaggaggtgagcggcagctgcagctgttccgggaagtcggccaacggt
tcggcgacggcctcgccgtcaagctgctcggcgacgcccagcgccatcctcgaggagatt
ttctacatatcgtccaagaggagcactttgtacagggtcaggctgaccgagaggggactc
agtctgcgaaaggagagcaactgcggtcccagcaagaccgagactatcctcgtcgaggac
atcgtcggatgcagatgcatgcgttcgaagcgtcgcagcgctggcagctgcgcctgcggg
ccaggtgcctctcgcggtcagccccatctagtggagtcgacggagcttgtccagccgcac
gacgagtacgacacctcggcctacctctacatctacgcgtacacgctgaaacgagccaag
gtggcgaacaaaggcgcgcgaagacgcgagcgcacaactgtcaccctgaggttccgcagc
ttcgaccgttacgaggacaatctgcgcgaggccagtcgctggaggctcgccatcaagtgt
ctgcttaacaggctgccagtgcccaaggcctacatgagccctgctcaccggaacttgcag
tccctactcagcgcctgtccagacgagtcgaagaacctgctggtgattctgaacccaaag
tcaggtccgggtcgaggccgtgagaacttccagcgacgagtgaacccgatcttatccgaa
gccgagctgccctacgacgtgtacataactcgacacccgaactacgcgagggactttgtg
cgcagccgcgatctgtcccaatggtcgggtctcgttctggtcggcggcgacggtatcgtc
ttcgaagccatcaacggtctgttgcagaggcccgactgggacaccgtcatgaagcagctg
cccatcgccgtcataccctgcggatcgggcaacggactcgccaagtctatcgcgttttcc
aaacaggagcccttcgaccagaacccgatgctgataagcgcgctctcggtggtgcgccgc
cgactgaaccagatggacctggtgcgcgtggagacacgcaagcagatcctctactcgttc
ctctcggtcggctggggtttactggccgacgtcgacatcgagagcgagcgactcagagcc
atcggagctcagaggttcaccctctggagcctcgccagactcataggactgaggacttat
aagggaagcgtatcttacctgccctgcgactcgccctcgactggcatcggggcacagagc
aacggggtcgtcaagagcaacggcgaactcgccaggatgcaggaggacgccaagatcacg
cactcgaagagctacggcgatgagctcgatagatacacgagcgagatccgggagtcgaag
agctacgacggcgttttcgacgacgtggaggacgagttgcacgacgtcgccgaagacgag
gtggactttggaggcgttatcacggacgctctgaccctcgagaccgagactgtctcgccg
agcagcgccactccgaacacgacgttcaccggacgccgacgctgcgacagcttctactcg
gccaagtcgaggaagtccgcctatttcagcactggctctggctcgatctcgagtacttat
cacagcgtcgaggacgtcaacaatcccaacaatgtggacggcgacggcagaagcaagatc
atttacgggccaccttcgtcgttgcctgcgctcactaccaaagtaccgagttcctggact
aagatagaaggcgaattcgtcatggtacaagccgcttatcagactcacttggggcaggac
tgttacttcgctccgcgagccaagatcgccgacggcataatctggcttctgatcatcagg
gcaggaatcagtcgaactaatctactgcagttcatgctcggattcagcacgggaacgcac
ctgagcaccccgggtgtcgagatgataccggtgcgagcgttcaggatcgagccagccgag
gacacgaacggcctgcttactgtcgacggcgaaaaggtcgactacggtccgctccagggc
gaaatcttcccgtccctagcgaccgtcatgtgcccttga

DBGET integrated database retrieval system