KEGG   Nasonia vitripennis (jewel wasp): 100123213Help
Entry
100123213         CDS       T01081                                 

Definition
(RefSeq) histone acetyltransferase type B catalytic subunit
  KO
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100123213
Chromosome [BR:nvi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100123213
   HAT complexes
    HATB complex
     100123213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 409 aa AA seqDB search
MEEAVAARLKPFVISSNDALEFKFVRKVEDLDDDETTFKPEMSHQVFGDSETIFGYKDLQ
VKLYYTAGSLETYLGMTYSEKVNKLVCQDVKPDEVLSKVAEKLAPDVHDNIDSFVKSLSK
DKAFIPAGENIYSFSVDDDGLVRHFEVYKADMSNKKFKEYHQRLQTFLLWYIDAANFIDI
DDDQWHYFNMFERYTDEDDSVRYATVGFATVYQYYAYPNLTRPRIAQVLILPPFQGIGLG
SHLLRAIYREYISRSEVKDITVEDPSEDFQRLRDYVDAMNCRTLPSFSKDNLVQGFNKSM
ANEAREKFKINKKQSRRIYEILRLRVTDVSNESEYRDYRLDVKKRLNIPYRREGNLKKLE
AAFKSNENRPGVSSLSIKEQRIQTLDKEFKALEDEYKKVIRRLDNNSDC
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcagtagcagctcgcttaaaaccgtttgtcattagtagcaatgatgctctt
gaattcaaatttgttcgtaaagttgaagatttggacgacgatgaaaccaccttcaaacca
gagatgtcacatcaagtatttggagatagtgaaaccatatttggatacaaggaccttcaa
gtaaaattgtattatacagctggtagtttggaaacttatttgggtatgacttattctgaa
aaagtaaacaaacttgtgtgtcaagatgtaaaacctgatgaagtcttgtccaaagtagct
gaaaagctagcacctgatgtacatgataatattgattcattcgtcaaatcactttctaaa
gataaagcttttataccagctggagaaaatatatattccttttctgtagatgatgatggt
ttagttagacattttgaagtgtacaaagctgacatgagcaacaaaaaatttaaagaatac
catcaacgtttgcaaacatttttgttatggtatattgatgctgcaaattttattgatatt
gatgacgaccaatggcattattttaacatgtttgaaaggtatacagatgaagatgactct
gttcgttatgctacagttggttttgcaactgtatatcagtattatgcttatcccaacctt
acaagaccccggatagctcaagttttaattttaccaccatttcaagggataggacttgga
agtcacttattgagggcaatttatcgtgaatatataagtcgttctgaagtcaaagatata
acagtggaagacccttctgaagattttcaacgcttgagggattatgtggatgctatgaat
tgccgtacattacctagcttctcaaaggacaatcttgttcaaggtttcaacaaaagcatg
gcaaacgaggctcgagaaaagtttaaaataaataagaaacaatctcgcagaatatatgaa
attctgagattacgagtgacggatgtatcaaacgaatctgaatatcgtgactatcgtttg
gatgttaaaaagagactcaacataccgtacaggagagagggaaatttgaaaaaactagag
gcggcattcaagtcaaacgaaaaccgaccgggtgtttcttccctctcaattaaagaacaa
cgtattcagactcttgataaggaattcaaagctttagaagacgaatacaagaaagtgatt
agaaggcttgataacaattccgactgttga

DBGET integrated database retrieval system