KEGG   Nasonia vitripennis (jewel wasp): 100123213Help
Entry
100123213         CDS       T01081                                 

Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100123213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 316 aa AA seqDB search
MEEAVAARLKPFVISSNDALEFKFVRKVEDLDDDETTFKPEMSHQVFGDSETIFGYKDLQ
VKLYYTAGSLETYLGMTYSEKVNKLVCQDVKPDEVLSKVAEKLAPDVHDNIDSFVKSLSK
DKAFIPAGENIYSFSVDDDGLVRHFEVYKADMSNKKFKEYHQRLQTFLLWYIDAANFIDI
DDDQWHYFNMFERYTDEDDSVRYATVGFATVYQYYAYPKNNLGRIYEILRLRVTDVSNES
EYRDYRLDVKKRLNIPYRREGNLKKLEAAFKSNENRPGVSSLSIKEQRIQTLDKEFKALE
DEYKKVIRRLDNNSDC
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcagtagcagctcgcttaaaaccgtttgtcattagtagcaatgatgctctt
gaattcaaatttgttcgtaaagttgaagatttggacgacgatgaaaccaccttcaaacca
gagatgtcacatcaagtatttggagatagtgaaaccatatttggatacaaggaccttcaa
gtaaaattgtattatacagctggtagtttggaaacttatttgggtatgacttattctgaa
aaagtaaacaaacttgtgtgtcaagatgtaaaacctgatgaagtcttgtccaaagtagct
gaaaagctagcacctgatgtacatgataatattgattcattcgtcaaatcactttctaaa
gataaagcttttataccagctggagaaaatatatattccttttctgtagatgatgatggt
ttagttagacattttgaagtgtacaaagctgacatgagcaacaaaaaatttaaagaatac
catcaacgtttgcaaacatttttgttatggtatattgatgctgcaaattttattgatatt
gatgacgaccaatggcattattttaacatgtttgaaaggtatacagatgaagatgactct
gttcgttatgctacagttggttttgcaactgtatatcagtattatgcttatcccaaaaac
aatctcggcagaatatatgaaattctgagattacgagtgacggatgtatcaaacgaatct
gaatatcgtgactatcgtttggatgttaaaaagagactcaacataccgtacaggagagag
ggaaatttgaaaaaactagaggcggcattcaagtcaaacgaaaaccgaccgggtgtttct
tccctctcaattaaagaacaacgtattcagactcttgataaggaattcaaagctttagaa
gacgaatacaagaaagtgattagaaggcttgataacaattccgactgttga

DBGET integrated database retrieval system