KEGG   Nasonia vitripennis (jewel wasp): 100123217Help
Entry
100123217         CDS       T01081                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100123217
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100123217
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100123217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 1222 aa AA seqDB search
MNGIIPEMEQIISQLERGTVVTKFFPRKRPEKKTLMIRRETRQIVWARSTTSRPFDGSVD
IREVKEIRIGKNSKDFEKWPEDAKRIDNLRCFVVYYGSEFRLKTLSISALSEKECELWIK
GLRHLMQDTINAPYPLQVERWLRKEFYAMENSREMVTLKDVKAFLPRVNCKIATNKLREV
FQEVDTKNRTEIGFDDFVILYHKLMFDPNVSNLTYWTRLLVYSNSGMLVTLQEFQNFLLT
EQQDPSGNIESDVSLFIREYLQDPQRDVQEPFFHFSEFIDFLFSKQNEIWDSQYDHVYHD
MTRPMSHYWIASSHNTYLMGDQISSESSCQAYVRALRVGCRCIELDCWDGPDGMPFIFHG
HTLTTKIKFLDVIKTIKEHAFVTSEYPVILSIEDNCTLPQQRKMAVAMQEVFGDMLLVQP
VDKSESTLPSPYALRRKILLKHKKLPDGVDESSFVIRNDESRQEMDLRNTIKNGILYLED
PVDREWNPHFFVLTQQKLFYTDTFSKPQETEPDDDDEAVVRTPGDGVPNDELHFGEMWFH
GKLARGREEAEELLRRYSNLGDGTFLVRQCVTFVGDYCLSFWRKGKVNHCRIKLKQDMGQ
TQFYLIDTHCFDSLYSLITYYRNNPLRSQEFLITLQEPVPQPSKHEEKEWWHSECSRTLA
EEMLKRVPTDGAFLVRPSEKENNCYAISFRAENKIKHCRIKLEGRLYAIGTVQFESLVEL
VNYYERHPLYKKIKLSFPVNQEIVRQRGLDVDDGSVYGIPGYMDPTTFVSKITVKAMYDY
KARRDDELTLVKHAIITNVNRQQNGGWWRGDYGGKKQHWFPANYVEEIEQDNQTDSSDSM
MLGNLQKGSLDIIGAVVELAMSDRPGLEWILRIQNPSMCSVFEAAAPSKDIAVEWVQKIH
ETGQNASVRENQHKEMERAWRIAKEMSNLIVYFRSVAFNVERLRAKGFIFNEMSSFPETK
AEKLMCQQENKFFLRYHQVQFSRVYPKGQRIDSSNYNPVPMWNSGCQMVALNYQTGDKPM
QLNQAKFRENGNCGYLLKPDFMFHEDFTPYDKSSLTGVDTLKITLHVIGARHLSKPGRGT
ASPFVQVEVVGADFDSGVKLTTKTITDNGFNPMWNESCEFLVANPYLAMLRFVVQDEDMF
GDSNFIGQATYPIRCLRTGYRSVVLKNSYSEDLELASLLVHVKIISSGDLMHNNTPKHDG
RSIALNSRAVDRDSQLSGRLHA
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaataattcctgaaatggagcagatcatcagtcagcttgaaagagggactgtg
gtcaccaagttctttccaagaaaaagaccagaaaagaagacattaatgatacgcagagaa
accagacaaatagtttgggcaagaagcaccacatcaagaccttttgatggctctgtggat
attcgagaagtgaaagaaataagaattggaaagaactcaaaagactttgagaaatggcca
gaagatgctaaacgaattgataatctacgttgttttgtagtttactatggctctgagttc
agactaaaaactctttcaatatcagctctgagtgaaaaagagtgtgaactctggattaaa
ggacttagacacttgatgcaagatactataaatgctccatacccattgcaagttgaaaga
tggctaagaaaagaattttatgcaatggaaaattccagagaaatggttactttaaaagat
gtcaaagcctttttaccaagagtaaactgtaagatagcaactaacaaactcagagaagtt
tttcaagaagtcgatacaaaaaatagaactgaaataggatttgacgattttgtgatactt
taccataaacttatgtttgatccaaacgtgagcaatttaacatattggacaagactgtta
gtttattctaactctgggatgttggtgacactacaagaatttcaaaattttctactcaca
gaacaacaagatccttcaggaaatattgaatcagacgtttcgctttttattcgcgagtat
ctgcaagatcctcaaagagacgttcaggaacctttttttcatttctctgaattcatagat
tttttgttttcaaaacagaatgaaatttgggatagtcaatatgatcatgtctatcacgat
atgactaggcctatgtctcattattggattgcttcatcgcataatacttacttgatgggt
gatcaaatcagtagtgagagcagttgccaagcatatgttagagctctgcgagttggttgc
aggtgtatagaactagattgctgggatggaccagatgggatgccttttatatttcatgga
catactttgacgacgaaaatcaaatttttagacgtaattaaaacaattaaagaacacgct
tttgtcacttccgaatatcctgtgattctctcaatagaagacaactgcacactaccgcaa
cagcggaaaatggctgtggctatgcaggaagtctttggcgacatgttgctggttcaaccc
gtcgacaagagtgaatccactttaccctcgccctacgctctgcgaagaaaaattctactc
aagcacaaaaagcttcccgacggcgttgacgaaagttcctttgtcattcgaaacgatgaa
agccgtcaagagatggatttgagaaacactattaaaaatggtatattgtatctggaggat
ccagtagatcgagaatggaatccacacttttttgtcctgacgcagcagaaactcttttat
acagatactttctcaaaaccgcaagaaaccgaaccggacgacgatgacgaagccgttgtt
agaactcccggtgatggtgttccaaacgatgaattacattttggagaaatgtggttccat
ggtaaattggccagaggaagagaggaagctgaagaacttttacgaaggtattccaattta
ggagatggaacgtttttggtcaggcaatgcgtgacctttgtgggagactattgcttatca
ttttggaggaaaggaaaagtcaatcattgccgtatcaagttaaaacaagacatgggtcag
acacagttttatttgatagacactcactgttttgacagtttatacagtctcatcacttat
tatcgtaataatcctctgagaagccaggaatttttaatcacattacaagaacctgtaccg
cagccaagtaaacacgaagaaaaagaatggtggcactctgaatgctcaagaacattggcc
gaggaaatgttgaagcgtgtaccaaccgatggagcgtttttagtgaggccaagcgaaaag
gagaataattgttacgccatttccttcagggctgaaaataaaataaagcattgccgcata
aaacttgaaggacggctatatgcaatcggaacagtgcaatttgaaagtttggtggaatta
gtcaattactacgaacgccatcctttgtataaaaaaattaagttaagttttccagttaat
caagaaatagtccggcaaagaggtttggatgttgacgacggttccgtatatggaattccg
ggctatatggatccaacaacttttgtttcaaaaatcacagtcaaagcaatgtacgattac
aaggctcgtcgagacgacgaattaactttagtaaaacatgctataattacgaatgtaaat
agacaacaaaacggtggttggtggagaggtgactatggtggtaagaagcagcactggttc
ccggccaattacgttgaagaaatcgagcaagataatcagacggattcatcagattcgatg
atgctgggaaatttgcaaaaaggctctttagacataataggcgctgttgtggagttagcc
atgtccgaccgacctggtttagaatggattttacggatacagaatccaagcatgtgctct
gttttcgaggcagcagctccatccaaagatatcgccgtcgaatgggtacaaaaaattcac
gagactggacaaaacgccagcgtcagggagaatcaacacaaagaaatggaaagagcttgg
aggatagcaaaagaaatgtccaatctcatagtttactttagatcagtagccttcaacgtg
gagcggctacgagccaagggatttattttcaacgaaatgagcagctttccggagactaaa
gcagaaaagcttatgtgccaacaagaaaacaaattctttttacgttatcaccaggtgcaa
ttcagccgagtctatcccaagggccaacgaatagattcttcaaattacaatccggtacct
atgtggaactcgggttgtcagatggtggccctaaattaccaaacaggcgataagccaatg
cagctaaatcaggcgaaatttcgagagaacggtaactgcggttatctgttgaagcctgat
tttatgtttcacgaagatttcactccgtacgataagagttcattgaccggagtggacacg
ttaaagattacgctgcacgtcataggtgcaagacacctaagtaagccgggaaggggcaca
gcgagtcctttcgtacaagtcgaagtagtgggtgcagatttcgatagcggcgttaagtta
acgactaagactattaccgataacggtttcaatcccatgtggaacgaatcctgtgagttc
ctagtagcaaatccatatttggctatgcttcggttcgttgttcaagacgaggatatgttt
ggagatagcaattttattggacaggcaacttaccctattcgctgcttgaggacaggttac
agaagtgttgttctgaaaaacagttatagcgaagaccttgaattggcgtctctcctagtg
catgtgaaaattattagctcaggtgacttgatgcacaataatactccaaaacacgatgga
cgatccattgctctgaactctcgagccgtggacagagattcacaactttctggaagattg
cacgcctag

DBGET integrated database retrieval system