KEGG   Nasonia vitripennis (jewel wasp): 100123220Help
Entry
100123220         CDS       T01081                                 

Gene name
Crebbp, Nejire
Definition
CREB binding protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:nvi04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:nvi04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:nvi04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:nvi04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:nvi04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 2626 aa AA seqDB search
MADHLVDGPPSKRPKLNDPFQGSSDSSNFMTNTDMFDLENDLPDDLLSTGSWGSATESAK
PPATGPGPGQQNGALDSDLRHVQQQQLSHHLIQQQVHALRYIFHEEIQQQQQQQQQQQQQ
QQQNPGGMSMNPGGMNSGLVMTSSGGATVAGSNNSMSGMAGGNLIVANSLNKQPLNTVTM
MGGPVNAQGIHHAGGQHGVGQMQNGPAGMINARVAMQQQAHMVAGPTRGQSPHQQVHQQV
GIVPGPGGPRMQAPPNISNMTNMGQMTAANSPYGYGSPGGGPGPVGAGPAVGVVTPQQRG
VAAGMAMQVNRFGGGPGGTGPVGPLGAGGAGVPGGQEGGMAQQAQPPAPSPAQPQSGAPS
GGQPGPQQATQSQVPGVVNQQRARPVTADPEKRKLIQQQLLLFLHAHNCQRRESQANGEQ
WQCNLPHCKTMKNVLNHMSSCQAGKHCTVPHCSSSRQIIGHWKHCTRNDCPVCLPLKQAE
KNWHSTGAAAAQPNSQASPSPSDMRRAYDTLGIAAPTTTQPGLLPAQGVGRGVRMATPGM
QAQPGAMANVRLTQREAPVGPGQSVVGGSQQVVAPNVSLPLSSDPSAVTAAAAAVASQST
PTSGTAGTSGNQPSAAAAAAAANIQQQLFGLTEGQPAGLMNDGNRLSNLQLPGGLQPGQV
TATPVQGTKEWHQSVTPDLRNHLVHKLVQAIFPTPDPQAMLDKRMHNLVAYARKVEGDMY
EAANSRSEYYHLLAEKIYKIQKELEEKRQKRKEQQLQAQQQQQPPTPGTAGSSLRPCAPP
GMNAGGPGVPRPISAVQPSLRSHSPGMGQLGLPGIGMPQNRMQFNQQAQQIQAQQVQAQQ
QQVQSQQQQQQQGMMVGPAGPSPNGQSVSNANMVANPGLSPFGQPQMSQANLTTTTASVT
TSQFPTSNGTTGLSNNSPIHNQSQFTEIMKVRIAQVQAAQAVQQQQQQQQQQQQQQQQQL
QHQQQTQPTSTSNQNVTATSIPQAQSPFGSMQQQQQNQQQNQQQQFLVNRPLSATTPNDN
GLAVSTPQTIPPPASSGPSPGATPMTNGPQSTTSTPNTPLVPSLMTPSQVVTSANQTPPH
PGTTPSPAGLGKGMSSQERAALNAPRSSSMSSQMAAITAALDRDNSPSPPTNNNKGKLDT
IKEETNIKMEMDQEEVSDNLRSDAGSGSGKNVNNDMTSASQMKMDIKQEPMDEGESGATG
SGHIKEEIKEEMVSGMGQESSSSDIKPAMPEPIPPSGSSTDKKPLCLFKPDELRQALMPT
LEKLYRQDPESLPFRQPVDPQALGIPDYFDIVKKPMDLSTIKRKLDTSQYSDPWQYVDDV
WMMFENAWLYNRKTSKVYRYCTKLSEVFEKEIDPVMQALGYCCGRKYTFNPQVLCCYGKQ
LCTIPRDAKYYSYQNSVKTYTIVSDRYTFCQKCFNDIPGDTVTLGDDPTQPQTIIKKEEF
QEMKNDHLEQEPFVMCTDCGRKVHQICVLHMEAIWPAGYTCDNCFKKKGQKRKDNKFSAK
RLPVTKLGTYIETRVNNFLKKKEAGAGEVSIRVVASSDKVVEVKPGMKSRFVDNGDMPGE
FPYRAKALFAFEEVDGTDVCFFGMHVQEYGSECTPPNTRRVYIAYLDSVHFFKPRQFRTA
VYHEILLGYLDYAKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLD
KGIVERIVVDYKDILKQAMEDKLSSAAELPYFEGDFWPNVLEESIKELNQEEEEKRKQAE
AAEAAAAANAIFSLSEDSETGPDGKKKGQKKAKKSNKSKANQRKNSKKSNTPQTGNDLSA
KIFATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPVLNCDLMDGRDAFLTMAKEKHYEFS
SLRRAKFSSMSMLYELHNQGSDKFVYNCNKCKSHVETRYHCTVCDDFDLCLSCKEKEGHP
HHMEKLGLDLDDGSSPSDAKQVNPIEARKFSIQRCIQSLVHACQCKDANCRLASCQRMKR
VVTHIKTCKRRTSGGCPICKQLVALCCHHARHCQEAKCPVPFCFNIKHKLKQQQHHQRLQ
QAQLLRRRMAVMTNTRPTGSESGVQSGPPQANPSMTTGVAMKPALVAAGHPTAHHQPGIG
MKPGPQTPPAHVLQVVKQVQEEAARQQAPHVGYGKVTPAGVGLGASVGVGVGQVGQPTGV
MPPPQMQRPMPAQMVNPQGTHLISMDQWTPNSNTLSNFRYQPNAVMQQNAGLRQQAPQLL
QQQQHPQQQQQQQQQPQQQQQQPGQPGIGGMGGQMPRQPGVIGGPAGQVGQNAIGKQALQ
QLMQTLRSPNTPEQQNQILHILKSNPPLMAAFIKQRQALALQQQTGQHGGNAGPLGPSQS
QQQQQQQQQQQQQQQPGLHMITPQQQQQQQTPQSRMQIQAMLSQQQQQQQQQQQGQQQVS
TVQQQQQQNQWYKQQQQQILLMQRQQAAVAAAAGSQPFTQPSAPPYGQQRPIRPPMLGYS
GFADQAYGQPGLKPTPPPVPSPQGVMGPPGISSVQQQLMQSVRSPPPIRSPQPNPSPRPV
PSPRNQPVPSPRANPVPSPHHLPGGGGGHVTPTHSPAHELGGPSEMMLSQLSQATGSQAP
GPGQAHPSAMPHHPSPAPPNQGGGQDANDVTPMTPQDQLSKFVEGL
NT seq 7881 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccaccttgtcgacgggccgcctagcaagcggcccaagctcaatgatcctttc
cagggctcctcggactcgtcgaatttcatgacaaacacagacatgtttgatcttgaaaat
gatctacccgacgatctgctgtcgacgggctcgtggggctcggcgacggaaagcgctaag
cctccagccactggaccagggcctggacaacaaaacggggcactggattcggatctacgt
cacgtgcaacagcagcagctttcacatcatctcattcagcaacaggtacatgcattgcgc
tatatcttccacgaagaaattcagcaacaacaacagcaacagcaacagcagcagcagcag
caacagcagaatcccggtggtatgtcgatgaacccgggcggcatgaactccggcctagtc
atgacgagtagcggcggcgccaccgtcgccggcagcaacaacagtatgagcggtatggcc
ggtggaaatctcatcgtggccaacagcctgaacaagcaacctttgaacacggtgacgatg
atgggcggccccgtgaacgctcagggtatccatcacgcaggtggtcagcacggcgtcggc
cagatgcagaatggacccgccggaatgatcaacgcccgagtggccatgcagcaacaggcg
cacatggtcgcagggcctaccaggggtcaaagccctcatcagcaggtgcaccagcaggtt
ggcatcgtgcccggacctggtggacctaggatgcaggcaccacccaatatctccaatatg
accaacatgggacagatgaccgcggctaacagtccttacggatatggttcgccaggtggc
ggtccaggtccagttggagcgggccctgcggtgggtgtagttacgccacagcagcgtggt
gttgctgcaggtatggccatgcaggtgaaccgatttggtggtgggccaggaggcaccgga
ccagttggtcctctgggggccggtggcgccggtgtacccggtggtcaggaaggcggtatg
gcccagcaggctcagccaccggcacccagtccggcccagccgcaaagtggtgcgcccagt
ggcggacagcccgggccacaacaggccacacagtcgcaggtgcccggcgttgttaatcag
caaagggcgcgaccagtgacggcagatccagagaagcgcaagctcattcagcagcagttg
cttctttttctgcatgcgcacaactgccagcgccgtgagagccaggctaacggcgagcaa
tggcagtgcaacttaccccattgcaaaaccatgaagaatgtgctaaaccacatgtcgagt
tgccaggcaggaaagcactgcacggtgccacattgcagctcgtctcgacagatcatcggt
cactggaagcactgcacgcggaatgactgcccggtctgtctgccactcaaacaggctgaa
aagaactggcattccaccggtgctgcagcagctcaacctaatagtcaagcgagccctagt
ccatcggatatgaggagagcgtacgacacccttggtatcgctgcgccaacaacgacgcaa
cccggcctgctgcctgctcaaggcgtcggccgaggcgttaggatggcgaccccaggtatg
caggcccaaccaggtgcaatggccaacgtcaggctaacgcaacgtgaagctccagtaggt
ccaggccagtcggttgtgggcggctcacaacaggtcgtcgcgccgaacgtttcgctaccc
ctgagttcggatccgtccgccgtgaccgctgcggctgcggcagtcgcgagccaatcgacg
ccgacgagcggtactgccggtacgtctggcaaccaaccctcggcagctgcagccgctgcc
gctgctaacatccagcagcagctcttcgggctgaccgagggacagccggcaggtctcatg
aacgacggcaacaggctatcgaatctccagctacccggcggtctgcaacctggccaagtc
actgcgacgcccgtccagggcaccaaggagtggcatcaatcagtcacgcccgatctcaga
aaccatcttgtacataaactggtccaagcgatattccctacccctgaccctcaagctatg
ctagataagagaatgcacaacttagttgcatacgccagaaaagttgaaggtgacatgtac
gaagctgccaactcaaggtcggagtattaccatctattagccgaaaaaatctacaagata
caaaaggaactcgaggagaaacgtcaaaagcgcaaggaacaacagttgcaagcgcaacaa
caacaacaaccaccgacgcccggtactgctggctccagtttaaggccgtgcgcgcccccg
gggatgaatgccggaggcccaggggtaccaaggcccattagcgctgtccaaccgtcactg
cgcagccattcgcctggtatgggccaactagggttgcctggtataggcatgccacagaac
cgtatgcaatttaatcagcaagcgcagcaaattcaggcgcaacaggttcaggctcagcag
cagcaagtacagtctcagcagcagcaacagcagcaagggatgatggtaggtccagcgggt
ccaagtcccaatggccaatctgtctctaacgcaaacatggtagcgaatccgggcttgagt
ccgttcgggcaaccccagatgtctcaggcgaacctcaccacgaccacggcatccgtgacg
actagtcaattcccaacgtccaacggcacgacgggcctgtccaataattcgcctatacac
aatcaaagccaatttaccgagatcatgaaagtcagaatagcacaggttcaggcggctcaa
gctgtccaacaacagcagcagcagcaacagcaacaacaacaacagcagcagcagcaactg
caacatcagcagcagactcagccgacgagtacatcgaatcaaaacgtaacggctacctcg
ataccccaagcccaatcgccgtttggcagtatgcagcaacagcagcagaatcaacagcaa
aatcagcaacagcagttcctcgtcaatcgtccgctctcggccacgacgccgaacgataat
gggctggcggtttcgacaccacagaccataccacctcccgcgtccagcggacccagtcct
ggtgccacgcccatgacgaatggaccccagtcgacgacatccacgcccaacacgccgctt
gtaccctcgctcatgacaccctcacaggtggtaacgagtgcaaatcaaacgccgccgcat
cctggcacgactccgtccccggcgggtctgggtaaggggatgtcttcgcaagagcgggca
gctcttaatgcgcctcgaagttcctccatgtcgtcgcagatggctgcgatcacagctgcc
ctcgaccgcgataactcacccagtccgcctacaaacaacaataagggcaagcttgatacc
atcaaagaggagactaacatcaagatggagatggaccaagaagaagttagcgataatctt
cgatcggatgcaggcagtggtagcggcaagaacgttaacaatgacatgaccagtgccagt
caaatgaaaatggatatcaaacaggagcctatggacgaaggcgagtctggtgctactggt
agtggacacatcaaggaggagattaaggaggagatggtgtcaggcatgggtcaagaatcc
tcgagtagcgacattaaaccagcaatgcctgagcctatcccaccaagtggtagttcgacc
gataagaagccgctgtgcctgtttaagcccgacgagctgcgacaggctcttatgcccacc
cttgagaaactctaccggcaggatcctgagtcgctgccattccggcaacccgttgatccc
caagccttgggtatccctgactactttgacattgtcaaaaagcctatggacctatcgacg
atcaaaaggaaactagacacgtctcagtacagcgacccttggcagtacgttgacgatgtg
tggatgatgtttgagaatgcctggttatataatcgcaagacttccaaagtttatagatat
tgtacaaagttatcggaagtcttcgaaaaagaaatagaccctgtgatgcaagcgctaggt
tattgttgcggcagaaaatacacgtttaatccccaagtactgtgctgttatggtaaacag
ctttgcacgattccaagggatgcgaaatactactcctatcagaacagtgtaaaaacgtat
actattgtttctgacagatacaccttctgtcaaaaatgtttcaacgacattccgggagat
acggtgacgttaggtgacgatcccactcagccacaaactattatcaaaaaggaagagttt
caagaaatgaaaaatgaccacttggaacaagagccttttgttatgtgcacagattgtggt
agaaaagtgcatcaaatatgtgtattacatatggaagcaatctggcctgcaggatatact
tgtgataattgttttaagaagaaaggccaaaagcgcaaagataacaagtttagtgcaaaa
cgtctacctgtgacgaagctcggcacgtacatcgagacacgagtcaataacttcctgaaa
aagaaagaagccggtgctggtgaggtgtctattcgcgttgtcgcctcgagcgacaaggtt
gtcgaagtcaaacctggaatgaagagtcgatttgttgacaacggtgacatgccgggcgaa
tttccttaccgagccaaagcattgtttgctttcgaagaggttgatggtaccgatgtttgc
ttctttggcatgcatgtacaggaatatggaagcgagtgtacgccaccaaacacgaggcga
gtttacattgcctaccttgactcggtgcactttttcaagcctcggcaattcaggacagca
gtctaccacgaaattcttctcggctacctagactacgcgaaacaacttggatatactatg
gcccatatttgggcgtgtccgccatcggaaggcgacgactatattttccactgccatcct
acagatcagaaaattccaaaacccaagagattacaagagtggtataaaaaaatgttggac
aagggtatcgttgaaagaatagtagttgactataaggatatattaaaacaagcaatggaa
gataagttgtcgtctgccgcggaattaccatacttcgaaggtgacttttggcctaacgtt
ctcgaagagagcataaaggaattgaatcaggaagaggaagaaaagcgtaagcaggccgag
gctgcggaagcagcggctgctgctaatgctatattctcattatcggaggattcggaaact
ggacctgacggcaaaaagaagggacaaaagaaagcgaaaaaatcgaataaatccaaagct
aatcaaagaaagaacagcaaaaaatcgaatactccgcaaactggaaacgatctctcggct
aaaatttttgccaccatggaaaagcataaagaagtatttttcgtaattagacttcacagt
gcacaaagtgcggctagcttggcgccaattcaagatcctgatccagttttaaactgtgac
ttgatggatggccgtgacgctttcctcacaatggcaaaagaaaagcattatgaattttcg
tcgcttaggcgagcaaagttcagttcaatgtctatgttatacgaattgcacaatcaagga
tcagataaatttgtttataattgtaataaatgtaagagccacgtcgaaacgaggtatcac
tgtaccgtatgcgatgacttcgatttgtgtctgagttgtaaagaaaaagaaggacacccg
caccatatggagaaacttggtttggacttggatgatggttcgtcgccgtccgatgcaaaa
caagtcaatcctatcgaagcgcgaaaattttcgatacaaaggtgtatacagtctctggtg
catgcatgccagtgcaaggacgcgaactgtcgattagccagttgccagagaatgaagagg
gtagtgacgcacataaagacctgcaagaggcgaacgagcggtggctgcccgatctgcaag
cagcttgttgcactttgctgtcatcatgcaaggcactgtcaggaggccaaatgtccggtg
cctttctgcttcaacatcaagcacaagctcaagcagcaacaacaccaccaacgcctacag
caagctcagttactaaggcgaagaatggctgtgatgacgaatacacgaccgaccggctca
gagtctggggtacagtctggtccaccccaggcaaatccttctatgacgacgggcgtcgcg
atgaaaccagccctcgttgcagctggtcatcccaccgctcaccatcagccgggtattggt
atgaaaccaggtccgcaaactccacctgctcacgtactgcaggtcgttaagcaagtacaa
gaagaggcggctcggcagcaagcgccccacgttggttatggcaaggtcacacctgcaggc
gttggtctcggggccagcgtgggagttggtgttggtcaggttggccaaccgacaggagta
atgccaccgccacagatgcaaaggcccatgccagcacaaatggtcaatcctcaaggcacg
catctcatatccatggatcaatggacaccgaacagcaatacgctatcgaactttagatat
cagcctaatgcggtgatgcagcaaaatgcgggcctgaggcagcaggcaccgcaattgctg
cagcaacaacagcatccacaacagcaacaacaacagcaacaacaaccgcagcagcaacag
cagcaaccaggtcagcctggtataggcggcatgggtggacagatgcccaggcaacccgga
gtgattggtgggcccgcgggtcaggtgggtcaaaacgcgattggaaaacaggcgctgcaa
caacttatgcagactcttagaagtccaaacacgcccgagcaacaaaaccaaatactccac
atactcaaaagcaatccacctcttatggctgcttttatcaaacaacgccaagcacttgcg
ctgcagcaacagacgggtcagcatggcggaaatgctggaccgctgggtcctagtcaatcc
cagcaacagcagcagcagcaacaacaacaacagcaacaacagcaaccaggcctacatatg
attacgccgcagcaacaacaacagcagcaaacgcctcaaagtcgcatgcagattcaagct
atgctgagtcagcagcaacaacaacagcagcaacagcagcagggtcagcagcaggtatcg
actgtgcagcaacagcaacaacagaatcaatggtacaaacagcagcagcagcagatattg
ttgatgcaaaggcagcaggcagcggtagcggcggccgcgggatctcagccattcacacag
ccgtctgcgccaccgtacggtcaacagaggcctatcaggccacctatgctaggttacagc
ggatttgccgatcaggcatacggacaaccgggtctaaagccaacgccacctcccgtccct
tcgcctcagggcgtaatgggtccacctgggatctcgtcggtgcaacagcagttaatgcaa
tcggtccgttcaccgccgccgattcgctcgcctcagcctaatccttcgccgcgacccgtg
ccgtcgccgcgcaatcaacccgtgccgtcgcctcgcgctaatcctgtaccttcgccgcac
catcttcccggtggcggtgggggccatgtaacgccgacccattcgccggctcacgagcta
ggcggccccagcgaaatgatgctgtcacagctcagtcaggcaacgggttctcaagcccct
gggcccggacaggcacacccctcggcgatgccgcatcatccgtcacctgcccctcctaat
caaggtggtggtcaggacgctaacgatgtaacacctatgacgccccaggatcaactgtcc
aagttcgtcgaaggattgtag

DBGET integrated database retrieval system