KEGG   Nasonia vitripennis (jewel wasp): 100123220Help
Entry
100123220         CDS       T01081                                 

Gene name
Crebbp, Nejire
Definition
histone acetyltransferase p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100123220 (Crebbp)
   04330 Notch signaling pathway
    100123220 (Crebbp)
   04350 TGF-beta signaling pathway
    100123220 (Crebbp)
   04630 Jak-STAT signaling pathway
    100123220 (Crebbp)
   04068 FoxO signaling pathway
    100123220 (Crebbp)
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100123220 (Crebbp)
Transcription factors [BR:nvi03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100123220 (Crebbp)
Mitochondrial biogenesis [BR:nvi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100123220 (Crebbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 2539 aa AA seqDB search
MSMQQQQANANQQQQQQQQQQQQQQQQQQNPGGMSMNPGGMNSGLVMTSSGGATVAGSNN
SMSGMAGGNLIVANSLNKQPLNTVTMMGGPVNAQGIHHAGGQHGVGQMQNGPAGMINARV
AMQQQAHMVAGPTRGQSPHQQVHQQVGIVPGPGGPRMQAPPNISNMTNMGQMTAANSPYG
YGSPGGGPGPVGAGPAVGVVTPQQRGVAAGMAMQVNRFGGGPGGTGPVGPLGAGGAGVPG
GQEGGMAQQAQPPAPSPAQPQSGAPSGGQPGPQQATQSQVPGVVNQQRARPVTADPEKRK
LIQQQLLLFLHAHNCQRRESQANGEQWQCNLPHCKTMKNVLNHMSSCQAGKHCTVPHCSS
SRQIIGHWKHCTRNDCPVCLPLKQAEKNWHSTGAAAAQPNSQASPSPSDMRRAYDTLGIA
APTTTQPGLLPAQGVGRGVRMATPGMQAQPGAMANVRLTQREAPVGPGQSVVGGSQQVVA
PNVSLPLSSDPSAVTAAAAAVASQSTPTSGTAGTSGNQPSAAAAAAAANIQQQLFGLTEG
QPAGLMNDGNRLSNLQLPGGLQPGQVTATPVQGTKEWHQSVTPDLRNHLVHKLVCFLYSR
VQAIFPTPDPQAMLDKRMHNLVAYARKVEGDMYEAANSRSEYYHLLAEKIYKIQKELEEK
RQKRKEQQLQAQQQQQPPTPGTAGSSLRPCAPPGMNAGGPGVPRPISAVQPSLRSHSPGM
GQLGLPGIGMPQNRMQFNQQAQQIQAQQVQAQQQQVQSQQQQQQQGMMVGPAGPSPNGQS
VSNANMVANPGLSPFGQPQMSQANLTTTTASVTTSQFPTSNGTTGLSNNSPIHNQSQFTE
IMKVRIAQVQAAQAVQQQQQQQQQQQQQQQQQLQHQQQTQPTSTSNQNVTATSIPQAQSP
FGSMQQQQQNQQQNQQQQFLVNRPLSATTPNDNGLAVSTPQTIPPPASSGPSPGATPMTN
GPQSTTSTPNTPLVPSLMTPSQVVTSANQTPPHPGTTPSPAGLGKGMSSQERAALNAPRS
SSMSSQMAAITAALDRDNSPSPPTNNNKGKLDTIKEETNIKMEMDQEEVSDNLRSDAGSG
SGKNVNNDMTSASQMKMDIKQEPMDEGESGATGSGHIKEEIKEEMVSGMGQESSSSDIKP
AMPEPIPPSGSSTDKKPLCLFKPDELRQALMPTLEKLYRQDPESLPFRQPVDPQALGIPD
YFDIVKKPMDLSTIKRKLDTSQYSDPWQYVDDVWMMFENAWLYNRKTSKVYRYCTKLSEV
FEKEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSVKTYTIVSDRY
TFCQKCFNDIPGDTVTLGDDPTQPQTIIKKEEFQEMKNDHLEQEPFVMCTDCGRKVHQIC
VLHMEAIWPAGYTCDNCFKKKGQKRKDNKFSAKRLPVTKLGTYIETRVNNFLKKKEAGAG
EVSIRVVASSDKVVEVKPGMKSRFVDNGDMPGEFPYRAKALFAFEEVDGTDVCFFGMHVQ
EYGSECTPPNTRRVYIAYLDSVHFFKPRQFRTAVYHEILLGYLDYAKQLGYTMAHIWACP
PSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGIVERIVVDYKDILKQAMEDKLSSAA
ELPYFEGDFWPNVLEESIKELNQEEEEKRKQAEAAEAAAAANAIFSLSEDSETGPDGKKK
GQKKAKKSNKSKANQRKNSKKSNTPQTGNDLSAKIFATMEKHKEVFFVIRLHSAQSAASL
APIQDPDPVLNCDLMDGRDAFLTMAKEKHYEFSSLRRAKFSSMSMLYELHNQGSDKFVYN
CNKCKSHVETRYHCTVCDDFDLCLSCKEKEGHPHHMEKLGLDLDDGSSPSDAKQVNPIEA
RKFSIQRCIQSLVHACQCKDANCRLASCQRMKRVVTHIKTCKRRTSGGCPICKQLVALCC
HHARHCQEAKCPVPFCFNIKHKLKQQQHHQRLQQAQLLRRRMAVMTNTRPTGSESGVQSG
PPQANPSMTTGVAMKPALVAAGHPTAHHQPGIGMKPGPQTPPAHVLQVVKQVQEEAARQQ
APHVGYGKVTPAGVGLGASVGVGVGQVGQPTGVMPPPQMQRPMPAQMVNPQGTHLISMDQ
WTPNSNTLSNFRYQPNAVMQQNAGLRQQAPQLLQQQQHPQQQQQQQQQPQQQQQQPGQPG
IGGMGGQMPRQPGVIGGPAGQVGQNAIGKQALQQLMQTLRSPNTPEQQNQILHILKSNPP
LMAAFIKQRQALALQQQTGQHGGNAGPLGPSQSQQQQQQQQQQQQQQQPGLHMITPQQQQ
QQQTPQSRMQIQAMLSQQQQQQQQQQQGQQQVSTVQQQQQQNQWYKQQQQQILLMQRQQA
AVAAAAGSQPFTQPSAPPYGQQRPIRPPMLGYSGFADQAYGQPGLKPTPPPVPSPQGVMG
PPGISSVQQQLMQSVRSPPPIRSPQPNPSPRPVPSPRNQPVPSPRANPVPSPHHLPGGGG
GHVTPTHSPAHELGGPSEMMLSQLSQATGSQAPGPGQAHPSAMPHHPSPAPPNQGGGQDA
NDVTPMTPQDQLSKFVEGL
NT seq 7620 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgcagcagcagcaggctaatgctaaccagcagcagcaacaacaacagcaacag
caacagcagcagcagcagcaacagcagaatcccggtggtatgtcgatgaacccgggcggc
atgaactccggcctagtcatgacgagtagcggcggcgccaccgtcgccggcagcaacaac
agtatgagcggtatggccggtggaaatctcatcgtggccaacagcctgaacaagcaacct
ttgaacacggtgacgatgatgggcggccccgtgaacgctcagggtatccatcacgcaggt
ggtcagcacggcgtcggccagatgcagaatggacccgccggaatgatcaacgcccgagtg
gccatgcagcaacaggcgcacatggtcgcagggcctaccaggggtcaaagccctcatcag
caggtgcaccagcaggttggcatcgtgcccggacctggtggacctaggatgcaggcacca
cccaatatctccaatatgaccaacatgggacagatgaccgcggctaacagtccttacgga
tatggttcgccaggtggcggtccaggtccagttggagcgggccctgcggtgggtgtagtt
acgccacagcagcgtggtgttgctgcaggtatggccatgcaggtgaaccgatttggtggt
gggccaggaggcaccggaccagttggtcctctgggggccggtggcgccggtgtacccggt
ggtcaggaaggcggtatggcccagcaggctcagccaccggcacccagtccggcccagccg
caaagtggtgcgcccagtggcggacagcccgggccacaacaggccacacagtcgcaggtg
cccggcgttgttaatcagcaaagggcgcgaccagtgacggcagatccagagaagcgcaag
ctcattcagcagcagttgcttctttttctgcatgcgcacaactgccagcgccgtgagagc
caggctaacggcgagcaatggcagtgcaacttaccccattgcaaaaccatgaagaatgtg
ctaaaccacatgtcgagttgccaggcaggaaagcactgcacggtgccacattgcagctcg
tctcgacagatcatcggtcactggaagcactgcacgcggaatgactgcccggtctgtctg
ccactcaaacaggctgaaaagaactggcattccaccggtgctgcagcagctcaacctaat
agtcaagcgagccctagtccatcggatatgaggagagcgtacgacacccttggtatcgct
gcgccaacaacgacgcaacccggcctgctgcctgctcaaggcgtcggccgaggcgttagg
atggcgaccccaggtatgcaggcccaaccaggtgcaatggccaacgtcaggctaacgcaa
cgtgaagctccagtaggtccaggccagtcggttgtgggcggctcacaacaggtcgtcgcg
ccgaacgtttcgctacccctgagttcggatccgtccgccgtgaccgctgcggctgcggca
gtcgcgagccaatcgacgccgacgagcggtactgccggtacgtctggcaaccaaccctcg
gcagctgcagccgctgccgctgctaacatccagcagcagctcttcgggctgaccgaggga
cagccggcaggtctcatgaacgacggcaacaggctatcgaatctccagctacccggcggt
ctgcaacctggccaagtcactgcgacgcccgtccagggcaccaaggagtggcatcaatca
gtcacgcccgatctcagaaaccatcttgtacataaacttgtgtgcttcctatattctagg
gtccaagcgatattccctacccctgaccctcaagctatgctagataagagaatgcacaac
ttagttgcatacgccagaaaagttgaaggtgacatgtacgaagctgccaactcaaggtcg
gagtattaccatctattagccgaaaaaatctacaagatacaaaaggaactcgaggagaaa
cgtcaaaagcgcaaggaacaacagttgcaagcgcaacaacaacaacaaccaccgacgccc
ggtactgctggctccagtttaaggccgtgcgcgcccccggggatgaatgccggaggccca
ggggtaccaaggcccattagcgctgtccaaccgtcactgcgcagccattcgcctggtatg
ggccaactagggttgcctggtataggcatgccacagaaccgtatgcaatttaatcagcaa
gcgcagcaaattcaggcgcaacaggttcaggctcagcagcagcaagtacagtctcagcag
cagcaacagcagcaagggatgatggtaggtccagcgggtccaagtcccaatggccaatct
gtctctaacgcaaacatggtagcgaatccgggcttgagtccgttcgggcaaccccagatg
tctcaggcgaacctcaccacgaccacggcatccgtgacgactagtcaattcccaacgtcc
aacggcacgacgggcctgtccaataattcgcctatacacaatcaaagccaatttaccgag
atcatgaaagtcagaatagcacaggttcaggcggctcaagctgtccaacaacagcagcag
cagcaacagcaacaacaacaacagcagcagcagcaactgcaacatcagcagcagactcag
ccgacgagtacatcgaatcaaaacgtaacggctacctcgataccccaagcccaatcgccg
tttggcagtatgcagcaacagcagcagaatcaacagcaaaatcagcaacagcagttcctc
gtcaatcgtccgctctcggccacgacgccgaacgataatgggctggcggtttcgacacca
cagaccataccacctcccgcgtccagcggacccagtcctggtgccacgcccatgacgaat
ggaccccagtcgacgacatccacgcccaacacgccgcttgtaccctcgctcatgacaccc
tcacaggtggtaacgagtgcaaatcaaacgccgccgcatcctggcacgactccgtccccg
gcgggtctgggtaaggggatgtcttcgcaagagcgggcagctcttaatgcgcctcgaagt
tcctccatgtcgtcgcagatggctgcgatcacagctgccctcgaccgcgataactcaccc
agtccgcctacaaacaacaataagggcaagcttgataccatcaaagaggagactaacatc
aagatggagatggaccaagaagaagttagcgataatcttcgatcggatgcaggcagtggt
agcggcaagaacgttaacaatgacatgaccagtgccagtcaaatgaaaatggatatcaaa
caggagcctatggacgaaggcgagtctggtgctactggtagtggacacatcaaggaggag
attaaggaggagatggtgtcaggcatgggtcaagaatcctcgagtagcgacattaaacca
gcaatgcctgagcctatcccaccaagtggtagttcgaccgataagaagccgctgtgcctg
tttaagcccgacgagctgcgacaggctcttatgcccacccttgagaaactctaccggcag
gatcctgagtcgctgccattccggcaacccgttgatccccaagccttgggtatccctgac
tactttgacattgtcaaaaagcctatggacctatcgacgatcaaaaggaaactagacacg
tctcagtacagcgacccttggcagtacgttgacgatgtgtggatgatgtttgagaatgcc
tggttatataatcgcaagacttccaaagtttatagatattgtacaaagttatcggaagtc
ttcgaaaaagaaatagaccctgtgatgcaagcgctaggttattgttgcggcagaaaatac
acgtttaatccccaagtactgtgctgttatggtaaacagctttgcacgattccaagggat
gcgaaatactactcctatcagaacagtgtaaaaacgtatactattgtttctgacagatac
accttctgtcaaaaatgtttcaacgacattccgggagatacggtgacgttaggtgacgat
cccactcagccacaaactattatcaaaaaggaagagtttcaagaaatgaaaaatgaccac
ttggaacaagagccttttgttatgtgcacagattgtggtagaaaagtgcatcaaatatgt
gtattacatatggaagcaatctggcctgcaggatatacttgtgataattgttttaagaag
aaaggccaaaagcgcaaagataacaagtttagtgcaaaacgtctacctgtgacgaagctc
ggcacgtacatcgagacacgagtcaataacttcctgaaaaagaaagaagccggtgctggt
gaggtgtctattcgcgttgtcgcctcgagcgacaaggttgtcgaagtcaaacctggaatg
aagagtcgatttgttgacaacggtgacatgccgggcgaatttccttaccgagccaaagca
ttgtttgctttcgaagaggttgatggtaccgatgtttgcttctttggcatgcatgtacag
gaatatggaagcgagtgtacgccaccaaacacgaggcgagtttacattgcctaccttgac
tcggtgcactttttcaagcctcggcaattcaggacagcagtctaccacgaaattcttctc
ggctacctagactacgcgaaacaacttggatatactatggcccatatttgggcgtgtccg
ccatcggaaggcgacgactatattttccactgccatcctacagatcagaaaattccaaaa
cccaagagattacaagagtggtataaaaaaatgttggacaagggtatcgttgaaagaata
gtagttgactataaggatatattaaaacaagcaatggaagataagttgtcgtctgccgcg
gaattaccatacttcgaaggtgacttttggcctaacgttctcgaagagagcataaaggaa
ttgaatcaggaagaggaagaaaagcgtaagcaggccgaggctgcggaagcagcggctgct
gctaatgctatattctcattatcggaggattcggaaactggacctgacggcaaaaagaag
ggacaaaagaaagcgaaaaaatcgaataaatccaaagctaatcaaagaaagaacagcaaa
aaatcgaatactccgcaaactggaaacgatctctcggctaaaatttttgccaccatggaa
aagcataaagaagtatttttcgtaattagacttcacagtgcacaaagtgcggctagcttg
gcgccaattcaagatcctgatccagttttaaactgtgacttgatggatggccgtgacgct
ttcctcacaatggcaaaagaaaagcattatgaattttcgtcgcttaggcgagcaaagttc
agttcaatgtctatgttatacgaattgcacaatcaaggatcagataaatttgtttataat
tgtaataaatgtaagagccacgtcgaaacgaggtatcactgtaccgtatgcgatgacttc
gatttgtgtctgagttgtaaagaaaaagaaggacacccgcaccatatggagaaacttggt
ttggacttggatgatggttcgtcgccgtccgatgcaaaacaagtcaatcctatcgaagcg
cgaaaattttcgatacaaaggtgtatacagtctctggtgcatgcatgccagtgcaaggac
gcgaactgtcgattagccagttgccagagaatgaagagggtagtgacgcacataaagacc
tgcaagaggcgaacgagcggtggctgcccgatctgcaagcagcttgttgcactttgctgt
catcatgcaaggcactgtcaggaggccaaatgtccggtgcctttctgcttcaacatcaag
cacaagctcaagcagcaacaacaccaccaacgcctacagcaagctcagttactaaggcga
agaatggctgtgatgacgaatacacgaccgaccggctcagagtctggggtacagtctggt
ccaccccaggcaaatccttctatgacgacgggcgtcgcgatgaaaccagccctcgttgca
gctggtcatcccaccgctcaccatcagccgggtattggtatgaaaccaggtccgcaaact
ccacctgctcacgtactgcaggtcgttaagcaagtacaagaagaggcggctcggcagcaa
gcgccccacgttggttatggcaaggtcacacctgcaggcgttggtctcggggccagcgtg
ggagttggtgttggtcaggttggccaaccgacaggagtaatgccaccgccacagatgcaa
aggcccatgccagcacaaatggtcaatcctcaaggcacgcatctcatatccatggatcaa
tggacaccgaacagcaatacgctatcgaactttagatatcagcctaatgcggtgatgcag
caaaatgcgggcctgaggcagcaggcaccgcaattgctgcagcaacaacagcatccacaa
cagcaacaacaacagcaacaacaaccgcagcagcaacagcagcaaccaggtcagcctggt
ataggcggcatgggtggacagatgcccaggcaacccggagtgattggtgggcccgcgggt
caggtgggtcaaaacgcgattggaaaacaggcgctgcaacaacttatgcagactcttaga
agtccaaacacgcccgagcaacaaaaccaaatactccacatactcaaaagcaatccacct
cttatggctgcttttatcaaacaacgccaagcacttgcgctgcagcaacagacgggtcag
catggcggaaatgctggaccgctgggtcctagtcaatcccagcaacagcagcagcagcaa
caacaacaacagcaacaacagcaaccaggcctacatatgattacgccgcagcaacaacaa
cagcagcaaacgcctcaaagtcgcatgcagattcaagctatgctgagtcagcagcaacaa
caacagcagcaacagcagcagggtcagcagcaggtatcgactgtgcagcaacagcaacaa
cagaatcaatggtacaaacagcagcagcagcagatattgttgatgcaaaggcagcaggca
gcggtagcggcggccgcgggatctcagccattcacacagccgtctgcgccaccgtacggt
caacagaggcctatcaggccacctatgctaggttacagcggatttgccgatcaggcatac
ggacaaccgggtctaaagccaacgccacctcccgtcccttcgcctcagggcgtaatgggt
ccacctgggatctcgtcggtgcaacagcagttaatgcaatcggtccgttcaccgccgccg
attcgctcgcctcagcctaatccttcgccgcgacccgtgccgtcgccgcgcaatcaaccc
gtgccgtcgcctcgcgctaatcctgtaccttcgccgcaccatcttcccggtggcggtggg
ggccatgtaacgccgacccattcgccggctcacgagctaggcggccccagcgaaatgatg
ctgtcacagctcagtcaggcaacgggttctcaagcccctgggcccggacaggcacacccc
tcggcgatgccgcatcatccgtcacctgcccctcctaatcaaggtggtggtcaggacgct
aacgatgtaacacctatgacgccccaggatcaactgtccaagttcgtcgaaggattgtag

DBGET integrated database retrieval system