KEGG   Nasonia vitripennis (jewel wasp): 100123305Help
Entry
100123305         CDS       T01081                                 

Gene name
ash1
Definition
histone-lysine N-methyltransferase ash1
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100123305 (ash1)
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100123305 (ash1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 2628 aa AA seqDB search
MSGDSSWNAVIHHPSELELQSWDWDGNDGEPERELPSTVDMGAIKDGGNWNPVTGVTTIN
SEDDSDSEEDSSGGSDGSCSYSDSNSDTDNDSSDGDSDSNSDCTSDHSEQTFSIRETNFE
QGGLKLKISMKVPRKEDLEKLRLDKARRLLPRRNKNILVKVSDCSTDDSDDSLNQTVAPY
SPIQQTLLQQQALQQAKQKLQQQQQQKELQLKQQQLKQQQQQNQLNSTALKPTPPQPVSL
TQSHQSPHYSTQPQQQHQPLLQQQPPQRPQQPPPLRQQQPHQQQPVIATAPASQPLQEIN
QEDLAAILPDQEHEDTPFDGFEDSESGRLVSKAIERMSLGADSDSSENVNERNPVPVYSS
SLLQQFVEKTAQLSEPRCKRRNVKQPVERKAREPAEYVCTSSNVSPDSGIQSVDNSPLHL
VSSVSPPPAATAAATANAVQSPVQAGAAGTSAASASTSSSNSKVSSTSAAKASSTTSSFS
TVSTTVTTTTSVSAATAAALAAKSKPVVNVDRVLNPPKRKPGRPAKVTSSSTQPRGPGRP
AKPKPQETIVPASKKEAAQPSEKPTVITKDSPCLKRAKVVVSQCSRPPVKQPPPPPRPPQ
PQEDDDDLESDETLDQRLKNRKSGLRKSIDSATTKQSTQVHQPEDAKVCLTRKKCLSKPA
QAFVAGKRAKETKSEQSQSSEEQLPGKRMRREKSTRKDASSSTPKLTSTERSDENTGKLD
SKKSSKENRLDLTSLSKRQLPARKTQQQQVQQQQQQTLPTSRRVLKENKANKKATTTNNN
NNNNDTSDILETNGVSVQAIISLPVINPMKSSDSTADSGGGEKKLSMGRGYRQPKRASQP
SRARIGQQRCRLRVSIKTTALHHHHHHHHKHRRRVAPPKTPIRVDPAVGQELERLIDEFS
KLCTLGKPGTTGGALGGSGTNGVNNAAAAVAALAAGAQMGELLLPHQIFRVKKPGKKRKG
AEISLTEEQNAGKVLKRRVKKEKTGSSSGSCSSGSNSSNASVTESSNPNEQRLPLKKRHY
HVSGVNSSSQEQPADGEDGEVEEGDEDDIDEEDDDDVEEDENEVEHEEEEERDQSHVEES
TETPIETPTVPASTPPKNEAEKKESVPPVSESKKKVKDALESTAVDKTETETSESNADKS
QNQLDSQPRRKKKIVKDLRVTVTKLPVENNHIIDKIEKLEKMCAGDKTSKSSAEKMLNKV
AKVLSEKIDKPETRSSDHNLRPERTAKNKQSKEDKETSANKPTKKDLEAIKAGKKETETN
KTIKKDIEANNRTVKKDVEANKSTKKDTDAGIKVTKKESESNKPHKKVSPDNAKLSKKDV
DINKITKKDPETSKKDLDNKLSIIKNSEVVLHKTIKHEAITTSVTSSTSSSLAAMMIKKK
IRRRKAINRTGFPTLKKKKKKSITTAILMKEELQKAAVNKVEKKPILVKTSSAEVKKPKV
EAKETKEKKKSEVPVTKSEVPPVKEAANKDENLESKKLGDEKILCDNDHASLEDNTQTCS
GQLRVRKDLVIECDGTKPCDKLCPVKYEKIQDSRMYDENATLEESLERYNQSQKVAVLSE
ENVRKLECANSHVSVKLEAHACLNNNNHRHRIRGSASPCPLTVKNLKRLRNDYDTESDAL
PSSDIASDDHDKQAGGSTRCRRKQPRWKKRYLQAGLFSDYFKEDEPRKASSSDSGASKNK
MVYDPNEHPHGLLPPPYHCGKFLRQREIPFQLPYDLWWLHTHSRLPGRDLVPSWNYRKIR
SNVYYDVKPTMHYEAQACECKPDAGCGDDCINRMVFSECSPQLCPCGERCKNQKIQKHDW
APGLQRFMTESKGWGVRTHEPIRTGEFILEYVGEVVSEREFKTRMATRYANDTHHYCLHL
DGGLVIDGHRMGGDGRFVNHSCEPNCEMQKWSVHGLPRMALFALRDITAGEELTYDYNFA
LFNPSEGQECRCGSEGCRGVIGGKSQRVARPALLSNQSSGGNSINNNGNVPTSVIPTIER
RSVGRPRKNARKTNSIGSAAPGHAGQQSGQSSLPASSSRKGGLCKRRIGPDGNPLPMPQI
KPLSHQQRCFVLEHRCFLVRNIEKLRRGKLPVSQPNAQNKGVVKVGGTVGSGMQTAKEKG
VGDVKANAEVFFTHLTALTNTGSRTVRTRRLAQAQDDPEVNKTAKLAKVLKDLYSIITNA
KDENDALLCTPFMTLPPKRKLPEYYEKVQEPIDLTTIDQNIDNGQYKTAEQFDQDVIKMF
DNNVRFFGRTSDIGISAARLRKLYLGSKADFVIPITEATGLPPSQAFLPPRGSTAGEEDV
IRCICGLHRDEGLMIQCERCLVWQHCDCVKADTSAESYLCERCQPRVVDYEIPLEGEEEE
EGKKFYVTLMRGELQLRTGDTVYVLRDTPEKHTYKTIQKFDYEQMDIFRIERLWKNDSGE
RFVYGHHYLRPHETYHEPTRKFYENEVVCAPLYEAVPCELVAGRCWVLDPHTFCKGRPVN
SSPEHIYVCEFRVDRQARLFTKVAKSRHQVCTKPYAFESFPQRIKHYRTYFPHSLDGIQS
GGKGTKDNKKKNGAEIEHSGNKTESRNNSKVNNKEQQPHKPRGRRRLVENAPITTDIDFD
QREERKKRLNSILLNLLDRMPNKSEPLDVSNLLERNRRNRKRPGILNP
NT seq 7887 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtgactccagctggaatgccgttatccatcacccatcagaactggaattacaa
agctgggattgggatggcaatgatggcgaaccagagcgtgaacttccctctacagttgac
atgggtgccatcaaagatggtggcaattggaatccagtcactggtgtaactacaataaat
tcagaagatgactctgattcagaagaagacagttctggcggaagcgatggcagttgctct
tattctgattcaaattcagatacagacaatgatagcagtgatggtgatagtgattcaaat
tctgactgtacgtcagatcacagcgagcaaacgttttcaattcgagaaacaaactttgag
cagggaggtttaaaattaaaaataagcatgaaagtacctaggaaagaagatttagaaaaa
ttaagacttgacaaggcaaggcgtttattgcctaggagaaataaaaatattttagttaag
gtatcagactgcagtactgatgattctgatgattcattaaatcaaactgtggcaccttat
tctccaatccaacaaactttactgcaacaacaagcactgcaacaggcaaagcaaaaatta
cagcagcagcagcagcaaaaagaactgcagctaaaacaacaacagttaaaacaacagcag
caacaaaatcaattgaattcgaccgcgcttaagccaacgccacctcaaccagtttcgttg
acgcagtctcaccaatctccgcattattccacacaaccacagcaacaacatcaaccacta
ctgcagcaacaaccacctcaacgaccgcagcagcctccaccgctacgacagcaacagcct
caccaacagcaaccggtcattgctacggctcccgcgtcgcagcccctgcaggagatcaat
caggaagacctcgcagcaatactacctgatcaggagcatgaggatacgccgttcgatgga
ttcgaggactcggagagtggtcggctcgtctcgaaagcgatcgagcgtatgtctcttggt
gcggattcagattcctcggagaatgtgaacgaacgcaacccggtgccggtttatagttcc
tcattgctgcagcagtttgtcgagaagacggctcagctgtcggagccacgttgcaagcga
cgaaacgtcaaacagccggttgagagaaaggctcgtgaacccgcggagtacgtttgcacc
tcgtccaacgtctcgccggattctggcatccaatcggtcgacaatagtccgttgcatctc
gtcagctcggtcagtccgcctcccgcggcaactgcggctgctaccgcgaacgctgtccag
tcgcccgtacaggcgggtgctgctggaacgagtgctgctagtgcatcgacgagcagtagc
aacagcaaagtttcatctacatcagcagcgaaggccagtagcacaacatcttcctttagc
acggtttcaacgaccgtgacgacgaccacatcagtgtcggcggcgacggccgcagcgctc
gcggcaaaatcgaagccagttgtaaacgtggaccgagtgctgaatcctcccaaacgcaaa
cccggtagaccagcaaaggtcacttcttcctcgacacaaccacgtggacctggtaggccg
gcaaaaccaaaaccccaggaaactattgtgccggcatctaaaaaggaagcagcacagccg
tcagaaaagccgacagtgattactaaagacagtccgtgtttaaaaagagctaaggtcgtt
gtgtcgcagtgtagcaggccgcctgttaaacagccgccgccgccgccacgaccaccacag
ccccaggaagatgatgatgatcttgaaagcgatgaaacgcttgaccagaggttaaagaac
agaaaatctggtctcagaaaatcgatcgatagtgctacaacaaagcagagtacacaagtg
catcaaccggaagatgcaaaagtgtgcttgactcgtaaaaagtgcctaagcaaaccagcg
caagctttcgtcgccggaaagcgcgctaaggagacaaagtccgaacaatctcaaagcagt
gaggagcaactacccggcaaaagaatgaggcgggaaaagtctacgaggaaggacgcttct
tccagtacgcctaaattgacgagtacggagcgaagcgacgaaaacactggcaaattggat
agtaagaagagttcaaaagaaaacaggctggacctgacaagtctgagtaaacggcaacta
ccggcgcgaaagactcaacaacagcaagtccagcagcagcaacaacagacactgccgacg
tcccggcgagtgctcaaggaaaacaaagctaataagaaggccactacgactaataacaat
aacaataacaacgataccagcgacattttggagacgaatggtgtcagtgtccaggccatc
atttctttgcccgtaatcaatccgatgaagagcagcgattcaactgcggatagcggtggt
ggcgaaaagaagttgtcgatgggacgtggctaccgacaaccgaagcgtgcttcgcagccg
tcgcgtgcccggatcggacagcaacggtgccgcctcagagtctcaatcaaaacaacagca
ctccatcatcaccatcatcatcatcacaaacatcggcgacgtgttgctccaccgaaaacg
cctattcgagtcgatccagctgtgggccaagaactcgagcgtctcatcgacgagttcagc
aagctctgcacactcggaaaaccaggaactactggcggtgctcttggaggtagcggcaca
aacggggtcaataatgcagctgcagcggtcgctgccctcgcggctggtgcgcagatgggc
gagctcctattaccccatcagatatttagggttaaaaaacctggcaagaaacgcaagggt
gccgaaattagccttacagaggaacagaatgctggcaaagtcttgaagcgtcgtgtgaag
aaggagaagacgggcagcagtagtggaagctgcagcagtggcagcaacagcagcaacgcc
agcgtaaccgaatctagcaacccgaacgagcagcgactgccgttaaaaaaacgtcactat
cacgtatccggtgtaaacagtagctcacaagagcaacctgctgacggtgaggacggggaa
gtcgaggagggtgacgaggatgacattgacgaggaagatgatgatgacgtcgaggaagac
gagaatgaggtagagcatgaagaagaagaggagcgcgaccagagtcacgttgaggagtct
accgagactcctatcgagactccaactgttcctgcttctactccaccgaagaacgaagca
gagaaaaaagagagcgtgcccccagttagcgaaagtaagaagaaggtcaaagatgcccta
gaaagtacggctgttgataaaactgaaactgaaaccagtgaatcgaacgccgataaatcg
cagaatcaactcgattcgcagcctaggcgtaaaaagaaaattgttaaagatttacgtgtg
acggtaacaaaattacccgttgagaataatcacattatcgataaaatcgaaaagttggag
aagatgtgcgcgggcgacaagacatcaaaatccagcgcagaaaaaatgttgaacaaagtt
gcgaaggttttatcagagaaaattgacaaaccagaaacacgctcttccgatcataatttg
cgcccagagcggactgctaaaaataagcagtccaaagaagataaagaaaccagtgcaaac
aaacctactaagaaagatttggaagccattaaagccggcaaaaaggaaaccgagacgaac
aaaaccatcaagaaagacattgaagctaataatagaactgtaaagaaagacgttgaagca
aataagtctacgaaaaaagatacagacgccggtattaaagtaactaagaaagaaagcgaa
tcaaataaacctcataaaaaggtcagtcctgataatgcaaaattatccaagaaggacgtc
gatatcaacaagataactaagaaagatcctgaaactagtaaaaaagatttagacaataag
ttaagcataatcaaaaacagcgaggtagttcttcataaaacaattaagcacgaggccatc
accacttctgtcacgagctccactagtagttccttagccgcgatgatgatcaagaaaaaa
atccgccgcagaaaggcaatcaatcgaacgggcttccctactcttaaaaagaaaaagaag
aagtcaatcacaactgccatattgatgaaggaagagttgcagaaggcggcagtcaacaag
gtcgagaagaaaccaattctagtgaagactagttctgccgaggtgaagaagccgaaggta
gaagcgaaagaaactaaagaaaagaagaaatctgaagttcctgtgactaaatccgaagtt
cctccggtaaaggaagcagcaaacaaagacgagaatctcgaaagcaaaaagttgggtgat
gaaaaaatattgtgcgataacgatcatgctagtctggaggataatactcaaacgtgttcg
ggacaacttagagttaggaaagacttggtgatcgagtgtgacggaactaagccgtgtgat
aagttatgcccggtgaagtacgaaaaaattcaggactccaggatgtacgatgagaatgca
actcttgaagaatctcttgaaagatacaatcagagccaaaaggtcgctgtactaagcgag
gaaaacgtacgcaaactcgagtgtgctaactcgcacgtaagcgttaagctcgaagcccat
gcctgtcttaataataataaccatcgacacaggatacgcggttcggccagtccgtgcccc
cttacagtaaagaatctcaagaggttgcgaaacgactacgacacggagagcgatgcgcta
cccagtagcgacatcgccagtgacgatcacgacaaacaagctggaggttcaacgcgttgt
cgcaggaagcaacctcgctggaagaagcgctacctgcaagccggtcttttctccgattac
tttaaagaagacgaaccgcgcaaggcttccagttccgactccggagctagtaagaacaag
atggtctacgaccctaacgaacatccgcacggtcttctgccgccaccgtatcactgcggc
aagtttctcagacaacgcgagatcccgttccagctaccctacgatctctggtggctgcac
acgcattctaggctgcctggcagagacctggttccatcttggaattacagaaaaattcgt
tcgaacgtgtattacgatgttaagccaactatgcattacgaagcacaagcttgcgaatgt
aagcccgacgctggttgtggtgacgattgcattaatcgtatggtattcagcgagtgttcg
cctcagttgtgcccatgtggtgaacgttgcaaaaaccagaagattcagaagcatgattgg
gcacctggtctgcaacgattcatgacagagtctaagggctggggcgtccgtactcatgaa
cccatcagaaccggtgaattcatcttggaatacgttggggaggtcgtatccgagcgcgag
tttaagacgcggatggctacgcgctacgctaatgacacacaccactattgtctacatctt
gacggtggcctcgtaattgatggacaccgcatgggaggtgatggtcgcttcgtcaaccac
tcatgtgaacctaattgcgagatgcaaaagtggagtgtccatggtttaccacgtatggct
ctatttgctctgcgcgacatcaccgctggcgaagaactgacttacgactacaatttcgcc
ctgttcaatccatccgagggacaagaatgcaggtgcggtagtgaaggttgtcgtggagtt
ataggtggcaagagccaacgagtcgcaaggcctgccctactgtcaaatcagtcgtctggc
ggcaacagcattaacaataacggcaacgttcctacaagtgtcatcccgaccatcgaaagg
cggtcagtgggtcgcccacgtaaaaacgcacgcaagaccaatagcattggtagcgctgcg
cctggacacgcaggccaacagtctggacaatcgagtctgccggcctcttctagtcgcaaa
ggcggtctttgcaaacgcagaatcggaccagatggaaatcccttaccgatgcctcagatc
aagccactctcacatcaacagcgctgcttcgtactcgaacaccgttgctttcttgtgcgt
aatatcgaaaaactacgcagaggcaaactacctgtctcgcagcctaatgctcagaataag
ggtgtagtgaaggttggtggaactgtaggaagtggaatgcagacagcgaaagaaaagggt
gtgggtgacgtgaaagccaacgccgaggtatttttcactcatctgactgcattaaccaac
acgggttcaagaaccgtaagaaccaggaggcttgcgcaggcgcaagatgatcctgaggtt
aataagactgctaaactagctaaggtattaaaagatctatattctataataacaaacgcg
aaagacgaaaatgatgcgcttctttgcacacccttcatgacgctaccgccgaagcgtaaa
ttacctgagtattacgagaaggttcaggaaccgatcgacctgaccactattgaccaaaat
atagacaatggccagtataagactgccgagcagtttgaccaagacgttattaaaatgttt
gacaacaacgtgaggttctttggtagaacctctgacattggtatatcagctgcaagatta
aggaaactctatcttggcagtaaggctgacttcgttattccaataactgaagccacagga
ttaccaccctcgcaggcattcctacctcccagaggttcaaccgctggcgaggaggatgtt
attagatgcatttgcggtttgcatagggacgaaggtttgatgatccagtgcgaacgttgc
ctggtctggcagcattgtgactgcgttaaagcagacacaagcgcagagtcttacttgtgt
gaacgatgccaacctcgagttgtagattacgagatacctcttgaaggcgaagaagaagaa
gaaggcaaaaagttttatgtcacactgatgcgaggagagctgcagttgaggacgggggac
acagtctacgtgctcagagatacgccagagaaacacacatataagacaatacaaaagttc
gattacgagcagatggacatcttcagaatcgagagattgtggaaaaacgatagtggcgaa
agattcgtatacgggcatcattatctacgaccgcatgagacgtatcacgaaccaacgcgt
aagttttatgagaacgaggttgtctgcgcgccgctgtacgaagctgtgccttgtgaatta
gtggccggccgatgttgggttcttgatccgcatacattctgcaaaggtcgcccagttaac
tcgagcccagagcacatatatgtatgcgagtttcgcgtggatcgacaagctagactattt
acgaaagtcgccaaatcgcgacatcaagtctgcacaaaaccgtatgctttcgaaagtttt
ccgcaacgtataaagcactacaggacttattttcctcacagtctcgatggcattcaatcc
ggaggaaaaggtacaaaagataataaaaagaaaaatggcgcagaaattgaacatagtggc
aacaaaacagaatctcggaataacagtaaagtgaataacaaagaacagcagccacataaa
cctcgaggacgaaggcgacttgttgaaaatgcacctataacaacagacatagacttcgat
cagagagaagaaagaaaaaagagactgaatagcattttgctaaacttactagacagaatg
ccaaataaaagcgaacccttggatgtgtcaaatcttttagaacgcaacagaagaaaccgg
aaaaggccgggaatactgaatccgtga

DBGET integrated database retrieval system