KEGG   Nasonia vitripennis (jewel wasp): 100123347Help
Entry
100123347         CDS       T01081                                 

Definition
acetyl-CoA carboxylase-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100123347
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100123347
   00640 Propanoate metabolism
    100123347
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100123347
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100123347
Enzymes [BR:nvi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100123347
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100123347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 2317 aa AA seqDB search
MAEPVSFVLGETEDDAGGEELAETGDSFPGDKLQHQTSQQGQQSLPNGLAERRRRLRPSM
SQGTVMIQAQSRLTEKDFTVATPEEFVHRFGGTRVITKVLIANNGIAAVKCMRSIRRWSY
EMFKNERAVRFVVMVTPEDLKANAEYIKMADQYVPVPGGSNNNNYANVELIVDIANRTQV
QAVWAGWGHASENPKLPELLHKNNVTFIGPSERAMWALGDKIASSIVAQTADVPTMAWSG
SDLKAQYSGKKIKISSELFKKGCVATVDEALSAAHKIGYPIMVKASEGGGGKGIRKVENA
EELPSLFRQVQAEVPGSPIFIMKLAKCARHLEVQLLADNYGNAISLFGRDCSIQRRHQKI
IEEAPAVIAKPDVFEEMEKAAVRLAKMVGYVSAGTVEYLYDTSGRYYFLELNPRLQVEHP
CTEMVSDVNLPAAQLQVAMGLPLHNIKDIRLMYGESPWGDTIIDFDQPRHKPQPWGHVIA
ARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVGASGGLHEFADSQFGHCFSWGEDR
HQARENLVIALKELSIRGDFRTTVEYLITLLETESFQTNNIDTAWLDALIAERVRSDKPD
VLLAITCGALHIAENTINAAFSGFQTSLERGQIQACIDLDNVVYIELINDGFKYKVQVTK
SGPNSYFLVMNGSYKEVEIHRLSDGGLLLSLDGGSFTTYMREEVERYRVVIGNQTCVFEK
ENDPSLLRCPSAGKLINYLVEDGGHVEANQAYAEIEVMKMVMNVTCSEPGTLFYVKRPGA
VLEAGSLIARLELDDPSLVTRAQDYNGQFPGPSSTAVPEKLNHLHAKYRAALENCLAGYC
LPEPYHLPRLRELVEKFMGSLRDPSLPLLELQEVIASISGRVPLSVEKKIRKLMTLYERN
ITSVLAQFPSQQIAAVIDGHAATLSKRAERDVFFLTTQAIVQLVQRYRNGIRGRMKTAVH
ELLRQYYTVEVHFQQGHYDKCVTALVEKYKDDISQVTGTIFSHIQVLKKNVLVTMLIDHL
WANEPGLTDELASTLTELTSLNRQEHSRVALRARQVLIAAHQPAYELRHNQMESIFLSAV
DMYGHDFHPENLQKLILSETCIFDILHDFFYHSNRAVCNAALEVYVRRAYISYELTCLQH
LELSGELPLVHFQFMLPSNHPNRQNHSLVNHRTGAMAAFKDLAQFSQYADEILDLLEDLS
SPTSLSAKVLEAVESAVGGSESRHSTSINVDQNAQPPQQVEAQKSEPVHILSIAVREESN
HDDATMARLFGEWCASNRDELTDRGIRRVTFAALKKRQFPKFFTFRQRDNFVEDRIYRHL
EPGCAFHIELNRMRTYDLEALPTSNQKMHLYLGQAKVAKGQQVTDYRFFIRSIIRHSDLI
TKEASFDYLHNEGERVLLEAMDELEVAFSHALAKRTDCNHIFLNFVPTVIMDPARIEESV
TSMVLRYGPRLWKLRVRQAEIKMTIRPAPGKPTSNVRLCISNDSGYSIDLHLYAEATDPK
TGVIRFESYCPSNSNTLNWRPGPMHGLPISTPYLTKDYLQAKRFQAQSAGTTYVYDLPDM
FRQQIEKAWAKHVEEAAALNEQVTIPNPVMDCVELVLEGENLVEQKRLPGENDVGMIAWR
LTLYTSECPNGRDIILIANDLTCFIGSFGPKEDLLFYRASEKARQLGIPRVYFSANAGAR
IGLAEEVKGLFHIAWEDKQDPEKGFKYIYLTPDDYARIGPLNSVKASLIEDEGESRYKLT
DIIGQQDGLGVENLKYAGLIAGETSRAYDEVVTISVVSCRAIGIGSYLVRLGQRVIQIEN
SHIVLTGYRALNSVLGREVYASNNQLGGIQIMHNNGISHAVEPRDLDGISTVLRWLSYVP
AVKGAPLPVSPIISDPIDREIMYLPTKAPYDPRWMLEGRPLPSDANVWESGFFDKGSWAE
IMRPWAQTVVTGRARLGGIPVGVIAVETRTVELHLPADPANLDSEAKTVSQAGQVWYPDS
AYKTAQAIKDFGKEELPLFIFANWRGFSGGMKDMYEQIMKFGAYIVDGLREYTRPIFVYI
PPNGELRGGAWAVVDPFINPQCMEMFAETTSRGGVLEPEAIVEIKFRQKDILKTIQREDE
IVQRLKEKIAALGSTCGPTEEKVALEAELQTREHQLEPMYHQVAVHFADLHDTPERMLEK
GCINEIVPWRNARRFFYWRLRRRLREDQLRRQILETQPELGERQVEAMLRRWFVEDKGAT
ESYLWDNDEAASNWMEKQITLDNSVLLRNMSCVKKDAVVSRIKKELEACPEVRLDAVLEM
AHRLVPQERAELQRSLAQLESPANQESGTDSSSSSSP
NT seq 6954 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaccggtgagttttgtcctgggcgagacggaggatgacgccggcggtgaggag
ctggccgagacgggggacagtttccccggggacaagctccagcatcagaccagccaacag
ggacagcagagtttgcccaatggcctagccgagcggcgcagacgcctcaggcccagcatg
tcgcagggcacggtgatgatccaggcgcagagtcggctcacggagaaggacttcaccgtc
gctacacccgaggagttcgtgcatcgattcggaggcactcgcgtcatcactaaggtcctg
atcgccaacaacggcatcgcggctgtgaaatgcatgcgatcaatccgtcgctggtcctac
gagatgttcaagaacgagagggccgtccgcttcgtcgttatggtcaccccggaggatctg
aaggccaacgcggagtacataaagatggcggaccagtacgtgccggttcccggaggcagc
aacaacaacaactacgcgaacgtagagctgatcgtcgacatagccaacaggacgcaggtt
caggccgtctgggccggctggggtcacgcctcggagaacccgaaactgcccgagcttctg
cacaagaacaacgtcaccttcatcggaccctcggagagggccatgtgggctctgggtgac
aagatcgcgtcgagcatcgtcgcgcagacggccgacgtgccgacgatggcctggtcgggc
tcggatctcaaggcccagtacagcggcaagaagatcaagatctcgtcggagctgttcaag
aagggttgcgtcgcgaccgtcgacgaggctctttccgcagctcacaagatcggctacccg
atcatggtgaaggctagcgagggtggcggtggcaagggtatcaggaaggtggagaacgcc
gaggaactgccctcgctcttcaggcaggtgcaggccgaagttcctggctcgccgatcttc
atcatgaagctcgccaaatgcgccaggcatttggaggtgcagctgctggccgacaattac
gggaacgcgatatcgctcttcggacgcgactgctccattcagaggaggcatcagaagatt
atcgaggaggcgcccgcggtcattgccaagcccgacgtcttcgaggagatggagaaagct
gcggtacggttggccaagatggtgggctatgtgagcgcgggaacagtcgagtacctgtac
gacacgtcgggtaggtactacttccttgagctgaatcccaggctgcaagtcgagcatccc
tgcacagagatggtgtcggacgttaacctgcccgcggctcagcttcaggtcgccatgggt
ttacctcttcacaatatcaaggacatcaggttgatgtacggagagagtccctggggtgac
accatcatcgacttcgatcagcccaggcacaagcctcagccgtggggtcacgttatagct
gctagaatcaccagtgagaaccccgacgagggtttcaagcccagcagcggtacggtccaa
gagctgaacttccgctcgtcgaagaacgtgtggggttacttctccgtgggagcctccgga
ggtctgcacgagttcgctgactcgcagtttggtcactgcttctcctggggagaggatcgg
caccaggcgcgcgagaaccttgtcattgctctgaaagaactgagcattcgtggtgacttc
cgtacgaccgtcgagtacctcatcactctgctcgagaccgagtccttccagacgaacaac
atcgacaccgcctggctggacgcgctcattgccgagcgcgtgcgcagcgataagcccgac
gtcctgctagctattacctgcggcgcgcttcacattgccgagaacaccatcaacgcggcc
ttcagtggattccaaacgtctctggaacgcggacagatacaggcttgcattgacctcgac
aacgtcgtctacatcgagctcatcaacgatggcttcaagtacaaggtccaggtgaccaag
tcgggtcccaacagctactttctggttatgaacggatcctacaaggaggtggagatacac
agactgtcggacgggggtcttcttctctccctcgatggaggcagcttcacgacctacatg
cgcgaggaggtcgagcgttaccgtgtcgtcatcggcaaccagacctgcgtcttcgaaaag
gaaaacgacccgtcgctgctgcgctgtccgtcggctggtaaactcatcaactacctcgtc
gaagacggtggccacgtagaagccaatcaggcctatgccgaaatcgaagtcatgaagatg
gtaatgaacgtcacgtgttccgagcctggcacgctcttctacgtcaaacgacctggtgcc
gtactcgaggctggtagtctcatagcccgccttgaactcgacgacccgtcgctcgtcact
agggctcaggactacaacggccagttccccggtcccagcagtaccgccgtacccgagaaa
ctgaatcaccttcacgccaagtaccgtgctgctttggagaactgcttggccggctactgt
ctacccgagccctatcacctacccagactacgcgagctggtcgagaagtttatgggatcg
ttgcgagatccctcgctgccgctcctcgaactccaggaggtcatagcgtcgatttcaggt
cgcgtaccgctcagcgtagagaagaagatccgcaaactcatgaccttgtacgagcgcaac
atcacatctgtgctcgctcagttcccaagccagcagattgccgccgtgatcgatggccac
gccgctaccttatcgaaacgagccgagcgcgacgtcttcttcctgacgacccaggcgatc
gtgcagctggtgcaacgctaccgcaacggcatccgcggtcgcatgaagacggcggtgcac
gagctactgcgccaatactacaccgtcgaggtgcacttccagcagggtcactacgacaag
tgtgttactgccctcgtcgagaagtacaaggatgacatcagccaagtcaccggaacgatc
ttcagtcacattcaggtcctcaagaagaacgtgctcgtcacgatgctgatcgaccatctc
tgggccaacgagccgggtctgacggacgagcttgcctcgactctgactgaattaacgagc
ctcaacagacaggagcacagccgcgtagcgctgcgcgctcgtcaggtactgatcgctgcc
catcaaccggcctacgagctccgacacaaccagatggagtccatcttcttgtcggcggtc
gacatgtacggtcacgacttccacccggagaacctgcaaaaactcattctgtccgagacc
tgcatcttcgacattctccacgacttcttctaccattctaacagggcggtctgcaacgct
gccctcgaggtctatgttcgtcgggcctacatcagttacgagctgacctgtctacagcat
ctcgagctatcgggtgaactgccgctcgtgcacttccagtttatgctgccgagcaatcac
cccaacagacagaaccactcgctggtgaatcaccgaaccggagcgatggccgctttcaag
gacctcgctcagttctcacagtacgccgatgaaattctcgatctcctcgaggacctgtca
tctcccacctccctctcggccaaagttctcgaagccgtcgaatccgctgtcggtggcagc
gagtctcgtcacagtacctccataaacgtggaccagaacgctcagcctccgcagcaggtc
gaagcccagaaatctgaacccgtgcatattctcagcattgccgtgcgcgaagagagcaac
catgacgatgccaccatggcccgtctcttcggcgagtggtgcgccagcaaccgcgacgag
ctcacagaccgaggtatcaggcgtgtgactttcgccgcgctgaagaagcgacagttcccc
aagttcttcactttccgtcagcgcgacaactttgtggaggacaggatctaccgccacctc
gagcccggctgcgcgttccacatcgaactgaatcgcatgcgcacctacgacctggaggca
ctgccgacctccaaccaaaagatgcacctctacctcggccaggcgaaggtggcaaagggt
caacaggtcacggactaccgcttctttatccgctcgatcattcgacactcggatctcatc
acaaaggaggccagcttcgactatctgcacaacgagggcgagcgggtattgctcgaagcg
atggacgaactcgaggttgccttctcacacgcgctggctaaacgcaccgactgcaatcac
atcttcctgaacttcgtgccgacggtcattatggacccagcgagaatcgaggagagcgtc
acgagtatggtactgcgctacggccccagactctggaaactcagagtcagacaggccgag
atcaagatgaccatcaggccggcgcccggaaagcccacttccaacgtcagactctgcatt
tctaacgacagcggatacagtatcgacctgcatctgtatgccgaggctaccgatcccaag
accggtgtgattaggttcgagtcgtactgtccgagcaatagcaacaccctcaactggagg
cccggaccgatgcacggtttgcccatttccacgccgtatctcacgaaggactatctgcag
gccaagagattccaggcgcagagtgctggaactacttacgtctatgatttgcctgatatg
ttccggcagcagattgagaaggcctgggctaagcacgtcgaagaagccgctgctcttaat
gagcaagtgaccatacctaatcccgtcatggactgcgtcgagctggttttggaaggcgag
aatctcgttgagcagaaacgattgccaggggagaacgacgttggtatgattgcttggaga
ttaacgctctacacatcggagtgtccaaatggccgagacatcattcttatcgccaacgat
ctgacgtgtttcatcggttcttttgggccgaaagaggatctgcttttctacagggcgtcg
gagaaagcgcggcagcttggcattcccagagtctacttttcggctaatgccggtgctcgt
attgggcttgcggaagaagtgaaaggtctgttccacatagcgtgggaagacaaacaggat
ccggaaaagggattcaagtacatatatctgacaccagacgattatgctcgcatcgggccg
ctgaattcggtaaaggcgagcttgatcgaggacgagggtgagtcgcgttacaaactcacc
gacattattggacagcaggatggactcggtgttgagaatctcaaatacgccggtttgatt
gccggtgaaacgtcgagagcgtacgacgaggtggtgacgatatccgtggtatcctgccgc
gctattggcattggctcgtacctcgttcgtctcggccagcgtgtcatccagatcgagaac
tcgcatatcgtcctcacaggttacagagccttgaactccgtgttgggtcgcgaggtctac
gctagcaacaaccaactcggtggcattcagatcatgcacaacaatggcatatcgcacgcg
gtagagccgcgcgacctggacggtatttccacagtcctcaggtggctgagctacgtgcca
gctgttaaaggcgcgccactgcctgttagccctatcatttccgatccgatcgacagagaa
atcatgtacttgcctaccaaggcgccttacgaccctcggtggatgctggagggtaggccg
ctgccttccgacgccaacgtttgggagagtggattcttcgacaaaggatcatgggcggag
atcatgaggccttgggctcaaacggtggtcacgggtagagcgagactcggcggtataccc
gtcggtgtgatagccgtagagacgcgcaccgtagagcttcacttaccagctgatccagca
aacttggactcggaggctaagactgtttcacaagccggacaagtctggtaccccgacagt
gcctacaagacggctcaggccatcaaagactttggcaaggaagagctgcctctgttcata
tttgccaactggcgtggtttctccggtggcatgaaagacatgtacgagcagatcatgaag
tttggtgcctacatcgtcgatgggctacgcgagtacacgcgaccaattttcgtgtacatt
ccacccaatggtgaattgaggggaggagcctgggccgtagtcgacccgttcatcaatccg
cagtgtatggagatgttcgcggaaacaacgagtcgcggtggcgtgctcgaacccgaggct
atcgtcgagatcaagttccgacagaaggacatcctgaaaacgatacagcgcgaggatgag
attgtccaacgtctcaaggagaagatcgcggcgctcggctcgacttgcggtcccaccgag
gagaaggtcgcgctcgaggctgagctgcagacgcgtgagcaccagctcgaacccatgtac
caccaggtagcggtacactttgccgacttgcacgacactcccgagcgaatgctcgagaag
ggctgcatcaacgagatcgtgccctggcgtaacgcgcgtcgcttcttctactggagactg
aggcgccggctgcgcgaagaccagctgcgccgacagatcttagagacacaacccgagctg
ggtgagcgccaggtcgaggcgatgctgcgtcgctggtttgtcgaagacaagggagctaca
gagtcctacctgtgggacaacgatgaggcagcgtccaattggatggagaaacagattaca
ctcgataacagtgtgttgctgcgtaacatgtcctgcgtgaagaaggacgcggtcgtcagt
aggataaagaaagagctcgaggcttgtcccgaggtcaggctggacgccgtcctggagatg
gctcacaggctggtgccccaggaacgagcggagttgcagcgatcactggcccaactggag
tcaccggccaaccaggagtcgggcaccgattcgagctcgtcgtcctcgccctag

  All links  
No link information was found.   
DBGET integrated database retrieval system