KEGG   Nasonia vitripennis (jewel wasp): 100123347Help
Entry
100123347         CDS       T01081                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00061  Fatty acid biosynthesis
nvi00620  Pyruvate metabolism
nvi00640  Propanoate metabolism
nvi01100  Metabolic pathways
nvi01212  Fatty acid metabolism
Module
nvi_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100123347
   00640 Propanoate metabolism
    100123347
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100123347
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100123347
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     100123347
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100123347
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100123347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp_3 ATP-grasp
Motif
Other DBs
NCBI-GeneID: 100123347
NCBI-ProteinID: XP_001606974
NASONIABASE: NV10237
Position
1
AA seq 2363 aa AA seqDB search
MSLVREIKIGNVKEEAASTRSTVEETAKEVDKLSSSSSSSSASEKTMAEPVSFVLGETED
DAGGEELAETGDSFPGDKLQHQTSQQGQQSLPNGLAERRRRLRPSMSQGTVMIQAQSRLT
EKDFTVATPEEFVHRFGGTRVITKVLIANNGIAAVKCMRSIRRWSYEMFKNERAVRFVVM
VTPEDLKANAEYIKMADQYVPVPGGSNNNNYANVELIVDIANRTQVQAVWAGWGHASENP
KLPELLHKNNVTFIGPSERAMWALGDKIASSIVAQTADVPTMAWSGSDLKAQYSGKKIKI
SSELFKKGCVATVDEALSAAHKIGYPIMVKASEGGGGKGIRKVENAEELPSLFRQVQAEV
PGSPIFIMKLAKCARHLEVQLLADNYGNAISLFGRDCSIQRRHQKIIEEAPAVIAKPDVF
EEMEKAAVRLAKMVGYVSAGTVEYLYDTSGRYYFLELNPRLQVEHPCTEMVSDVNLPAAQ
LQVAMGLPLHNIKDIRLMYGESPWGDTIIDFDQPRHKPQPWGHVIAARITSENPDEGFKP
SSGTVQELNFRSSKNVWGYFSVGASGGLHEFADSQFGHCFSWGEDRHQARENLVIALKEL
SIRGDFRTTVEYLITLLETESFQTNNIDTAWLDALIAERVRSDKPDVLLAITCGALHIAE
NTINAAFSGFQTSLERGQIQACIDLDNVVYIELINDGFKYKVQVTKSGPNSYFLVMNGSY
KEVEIHRLSDGGLLLSLDGGSFTTYMREEVERYRVVIGNQTCVFEKENDPSLLRCPSAGK
LINYLVEDGGHVEANQAYAEIEVMKMVMNVTCSEPGTLFYVKRPGAVLEAGSLIARLELD
DPSLVTRAQDYNGQFPGPSSTAVPEKLNHLHAKYRAALENCLAGYCLPEPYHLPRLRELV
EKFMGSLRDPSLPLLELQEVIASISGRVPLSVEKKIRKLMTLYERNITSVLAQFPSQQIA
AVIDGHAATLSKRAERDVFFLTTQAIVQLVQRYRNGIRGRMKTAVHELLRQYYTVEVHFQ
QGHYDKCVTALVEKYKDDISQVTGTIFSHIQVLKKNVLVTMLIDHLWANEPGLTDELAST
LTELTSLNRQEHSRVALRARQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQK
LILSETCIFDILHDFFYHSNRAVCNAALEVYVRRAYISYELTCLQHLELSGELPLVHFQF
MLPSNHPNRQNHSLVNHRTGAMAAFKDLAQFSQYADEILDLLEDLSSPTSLSAKVLEAVE
SAVGGSESRHSTSINVDQNAQPPQQVEAQKSEPVHILSIAVREESNHDDATMARLFGEWC
ASNRDELTDRGIRRVTFAALKKRQFPKFFTFRQRDNFVEDRIYRHLEPGCAFHIELNRMR
TYDLEALPTSNQKMHLYLGQAKVAKGQQVTDYRFFIRSIIRHSDLITKEASFDYLHNEGE
RVLLEAMDELEVAFSHALAKRTDCNHIFLNFVPTVIMDPARIEESVTSMVLRYGPRLWKL
RVRQAEIKMTIRPAPGKPTSNVRLCISNDSGYSIDLHLYAEATDPKTGVIRFESYCPSNS
NTLNWRPGPMHGLPISTPYLTKDYLQAKRFQAQSAGTTYVYDLPDMFRQQIEKAWAKHVE
EAAALNEQVTIPNPVMDCVELVLEGENLVEQKRLPGENDVGMIAWRLTLYTSECPNGRDI
ILIANDLTCFIGSFGPKEDLLFYRASEKARQLGIPRVYFSANAGARIGLAEEVKGLFHIA
WEDKQDPEKGFKYIYLTPDDYARIGPLNSVKASLIEDEGESRYKLTDIIGQQDGLGVENL
KYAGLIAGETSRAYDEVVTISVVSCRAIGIGSYLVRLGQRVIQIENSHIVLTGYRALNSV
LGREVYASNNQLGGIQIMHNNGISHAVEPRDLDGISTVLRWLSYVPAVKGAPLPVSPIIS
DPIDREIMYLPTKAPYDPRWMLEGRPLPSDANVWESGFFDKGSWAEIMRPWAQTVVTGRA
RLGGIPVGVIAVETRTVELHLPADPANLDSEAKTVSQAGQVWYPDSAYKTAQAIKDFGKE
ELPLFIFANWRGFSGGMKDMYEQIMKFGAYIVDGLREYTRPIFVYIPPNGELRGGAWAVV
DPFINPQCMEMFAETTSRGGVLEPEAIVEIKFRQKDILKTIQREDEIVQRLKEKIAALGS
TCGPTEEKVALEAELQTREHQLEPMYHQVAVHFADLHDTPERMLEKGCINEIVPWRNARR
FFYWRLRRRLREDQLRRQILETQPELGERQVEAMLRRWFVEDKGATESYLWDNDEAASNW
MEKQITLDNSVLLRNMSCVKKDAVVSRIKKELEACPEVRLDAVLEMAHRLVPQERAELQR
SLAQLESPANQESGTDSSSSSSP
NT seq 7092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttgtgagggaaataaaaattggtaacgttaaggaagaagcggcgtcgacgagg
agcacagtcgaggaaacagccaaggaggtcgataaattgtcgtcatcatcatcatcatcg
tcggcgagtgaaaagacgatggcagaaccggtgagttttgtcctgggcgagacggaggat
gacgccggcggtgaggagctggccgagacgggggacagtttccccggggacaagctccag
catcagaccagccaacagggacagcagagtttgcccaatggcctagccgagcggcgcaga
cgcctcaggcccagcatgtcgcagggcacggtgatgatccaggcgcagagtcggctcacg
gagaaggacttcaccgtcgctacacccgaggagttcgtgcatcgattcggaggcactcgc
gtcatcactaaggtcctgatcgccaacaacggcatcgcggctgtgaaatgcatgcgatca
atccgtcgctggtcctacgagatgttcaagaacgagagggccgtccgcttcgtcgttatg
gtcaccccggaggatctgaaggccaacgcggagtacataaagatggcggaccagtacgtg
ccggttcccggaggcagcaacaacaacaactacgcgaacgtagagctgatcgtcgacata
gccaacaggacgcaggttcaggccgtctgggccggctggggtcacgcctcggagaacccg
aaactgcccgagcttctgcacaagaacaacgtcaccttcatcggaccctcggagagggcc
atgtgggctctgggtgacaagatcgcgtcgagcatcgtcgcgcagacggccgacgtgccg
acgatggcctggtcgggctcggatctcaaggcccagtacagcggcaagaagatcaagatc
tcgtcggagctgttcaagaagggttgcgtcgcgaccgtcgacgaggctctttccgcagct
cacaagatcggctacccgatcatggtgaaggctagcgagggtggcggtggcaagggtatc
aggaaggtggagaacgccgaggaactgccctcgctcttcaggcaggtgcaggccgaagtt
cctggctcgccgatcttcatcatgaagctcgccaaatgcgccaggcatttggaggtgcag
ctgctggccgacaattacgggaacgcgatatcgctcttcggacgcgactgctccattcag
aggaggcatcagaagattatcgaggaggcgcccgcggtcattgccaagcccgacgtcttc
gaggagatggagaaagctgcggtacggttggccaagatggtgggctatgtgagcgcggga
acagtcgagtacctgtacgacacgtcgggtaggtactacttccttgagctgaatcccagg
ctgcaagtcgagcatccctgcacagagatggtgtcggacgttaacctgcccgcggctcag
cttcaggtcgccatgggtttacctcttcacaatatcaaggacatcaggttgatgtacgga
gagagtccctggggtgacaccatcatcgacttcgatcagcccaggcacaagcctcagccg
tggggtcacgttatagctgctagaatcaccagtgagaaccccgacgagggtttcaagccc
agcagcggtacggtccaagagctgaacttccgctcgtcgaagaacgtgtggggttacttc
tccgtgggagcctccggaggtctgcacgagttcgctgactcgcagtttggtcactgcttc
tcctggggagaggatcggcaccaggcgcgcgagaaccttgtcattgctctgaaagaactg
agcattcgtggtgacttccgtacgaccgtcgagtacctcatcactctgctcgagaccgag
tccttccagacgaacaacatcgacaccgcctggctggacgcgctcattgccgagcgcgtg
cgcagcgataagcccgacgtcctgctagctattacctgcggcgcgcttcacattgccgag
aacaccatcaacgcggccttcagtggattccaaacgtctctggaacgcggacagatacag
gcttgcattgacctcgacaacgtcgtctacatcgagctcatcaacgatggcttcaagtac
aaggtccaggtgaccaagtcgggtcccaacagctactttctggttatgaacggatcctac
aaggaggtggagatacacagactgtcggacgggggtcttcttctctccctcgatggaggc
agcttcacgacctacatgcgcgaggaggtcgagcgttaccgtgtcgtcatcggcaaccag
acctgcgtcttcgaaaaggaaaacgacccgtcgctgctgcgctgtccgtcggctggtaaa
ctcatcaactacctcgtcgaagacggtggccacgtagaagccaatcaggcctatgccgaa
atcgaagtcatgaagatggtaatgaacgtcacgtgttccgagcctggcacgctcttctac
gtcaaacgacctggtgccgtactcgaggctggtagtctcatagcccgccttgaactcgac
gacccgtcgctcgtcactagggctcaggactacaacggccagttccccggtcccagcagt
accgccgtacccgagaaactgaatcaccttcacgccaagtaccgtgctgctttggagaac
tgcttggccggctactgtctacccgagccctatcacctacccagactacgcgagctggtc
gagaagtttatgggatcgttgcgagatccctcgctgccgctcctcgaactccaggaggtc
atagcgtcgatttcaggtcgcgtaccgctcagcgtagagaagaagatccgcaaactcatg
accttgtacgagcgcaacatcacatctgtgctcgctcagttcccaagccagcagattgcc
gccgtgatcgatggccacgccgctaccttatcgaaacgagccgagcgcgacgtcttcttc
ctgacgacccaggcgatcgtgcagctggtgcaacgctaccgcaacggcatccgcggtcgc
atgaagacggcggtgcacgagctactgcgccaatactacaccgtcgaggtgcacttccag
cagggtcactacgacaagtgtgttactgccctcgtcgagaagtacaaggatgacatcagc
caagtcaccggaacgatcttcagtcacattcaggtcctcaagaagaacgtgctcgtcacg
atgctgatcgaccatctctgggccaacgagccgggtctgacggacgagcttgcctcgact
ctgactgaattaacgagcctcaacagacaggagcacagccgcgtagcgctgcgcgctcgt
caggtactgatcgctgcccatcaaccggcctacgagctccgacacaaccagatggagtcc
atcttcttgtcggcggtcgacatgtacggtcacgacttccacccggagaacctgcaaaaa
ctcattctgtccgagacctgcatcttcgacattctccacgacttcttctaccattctaac
agggcggtctgcaacgctgccctcgaggtctatgttcgtcgggcctacatcagttacgag
ctgacctgtctacagcatctcgagctatcgggtgaactgccgctcgtgcacttccagttt
atgctgccgagcaatcaccccaacagacagaaccactcgctggtgaatcaccgaaccgga
gcgatggccgctttcaaggacctcgctcagttctcacagtacgccgatgaaattctcgat
ctcctcgaggacctgtcatctcccacctccctctcggccaaagttctcgaagccgtcgaa
tccgctgtcggtggcagcgagtctcgtcacagtacctccataaacgtggaccagaacgct
cagcctccgcagcaggtcgaagcccagaaatctgaacccgtgcatattctcagcattgcc
gtgcgcgaagagagcaaccatgacgatgccaccatggcccgtctcttcggcgagtggtgc
gccagcaaccgcgacgagctcacagaccgaggtatcaggcgtgtgactttcgccgcgctg
aagaagcgacagttccccaagttcttcactttccgtcagcgcgacaactttgtggaggac
aggatctaccgccacctcgagcccggctgcgcgttccacatcgaactgaatcgcatgcgc
acctacgacctggaggcactgccgacctccaaccaaaagatgcacctctacctcggccag
gcgaaggtggcaaagggtcaacaggtcacggactaccgcttctttatccgctcgatcatt
cgacactcggatctcatcacaaaggaggccagcttcgactatctgcacaacgagggcgag
cgggtattgctcgaagcgatggacgaactcgaggttgccttctcacacgcgctggctaaa
cgcaccgactgcaatcacatcttcctgaacttcgtgccgacggtcattatggacccagcg
agaatcgaggagagcgtcacgagtatggtactgcgctacggccccagactctggaaactc
agagtcagacaggccgagatcaagatgaccatcaggccggcgcccggaaagcccacttcc
aacgtcagactctgcatttctaacgacagcggatacagtatcgacctgcatctgtatgcc
gaggctaccgatcccaagaccggtgtgattaggttcgagtcgtactgtccgagcaatagc
aacaccctcaactggaggcccggaccgatgcacggtttgcccatttccacgccgtatctc
acgaaggactatctgcaggccaagagattccaggcgcagagtgctggaactacttacgtc
tatgatttgcctgatatgttccggcagcagattgagaaggcctgggctaagcacgtcgaa
gaagccgctgctcttaatgagcaagtgaccatacctaatcccgtcatggactgcgtcgag
ctggttttggaaggcgagaatctcgttgagcagaaacgattgccaggggagaacgacgtt
ggtatgattgcttggagattaacgctctacacatcggagtgtccaaatggccgagacatc
attcttatcgccaacgatctgacgtgtttcatcggttcttttgggccgaaagaggatctg
cttttctacagggcgtcggagaaagcgcggcagcttggcattcccagagtctacttttcg
gctaatgccggtgctcgtattgggcttgcggaagaagtgaaaggtctgttccacatagcg
tgggaagacaaacaggatccggaaaagggattcaagtacatatatctgacaccagacgat
tatgctcgcatcgggccgctgaattcggtaaaggcgagcttgatcgaggacgagggtgag
tcgcgttacaaactcaccgacattattggacagcaggatggactcggtgttgagaatctc
aaatacgccggtttgattgccggtgaaacgtcgagagcgtacgacgaggtggtgacgata
tccgtggtatcctgccgcgctattggcattggctcgtacctcgttcgtctcggccagcgt
gtcatccagatcgagaactcgcatatcgtcctcacaggttacagagccttgaactccgtg
ttgggtcgcgaggtctacgctagcaacaaccaactcggtggcattcagatcatgcacaac
aatggcatatcgcacgcggtagagccgcgcgacctggacggtatttccacagtcctcagg
tggctgagctacgtgccagctgttaaaggcgcgccactgcctgttagccctatcatttcc
gatccgatcgacagagaaatcatgtacttgcctaccaaggcgccttacgaccctcggtgg
atgctggagggtaggccgctgccttccgacgccaacgtttgggagagtggattcttcgac
aaaggatcatgggcggagatcatgaggccttgggctcaaacggtggtcacgggtagagcg
agactcggcggtatacccgtcggtgtgatagccgtagagacgcgcaccgtagagcttcac
ttaccagctgatccagcaaacttggactcggaggctaagactgtttcacaagccggacaa
gtctggtaccccgacagtgcctacaagacggctcaggccatcaaagactttggcaaggaa
gagctgcctctgttcatatttgccaactggcgtggtttctccggtggcatgaaagacatg
tacgagcagatcatgaagtttggtgcctacatcgtcgatgggctacgcgagtacacgcga
ccaattttcgtgtacattccacccaatggtgaattgaggggaggagcctgggccgtagtc
gacccgttcatcaatccgcagtgtatggagatgttcgcggaaacaacgagtcgcggtggc
gtgctcgaacccgaggctatcgtcgagatcaagttccgacagaaggacatcctgaaaacg
atacagcgcgaggatgagattgtccaacgtctcaaggagaagatcgcggcgctcggctcg
acttgcggtcccaccgaggagaaggtcgcgctcgaggctgagctgcagacgcgtgagcac
cagctcgaacccatgtaccaccaggtagcggtacactttgccgacttgcacgacactccc
gagcgaatgctcgagaagggctgcatcaacgagatcgtgccctggcgtaacgcgcgtcgc
ttcttctactggagactgaggcgccggctgcgcgaagaccagctgcgccgacagatctta
gagacacaacccgagctgggtgagcgccaggtcgaggcgatgctgcgtcgctggtttgtc
gaagacaagggagctacagagtcctacctgtgggacaacgatgaggcagcgtccaattgg
atggagaaacagattacactcgataacagtgtgttgctgcgtaacatgtcctgcgtgaag
aaggacgcggtcgtcagtaggataaagaaagagctcgaggcttgtcccgaggtcaggctg
gacgccgtcctggagatggctcacaggctggtgccccaggaacgagcggagttgcagcga
tcactggcccaactggagtcaccggccaaccaggagtcgggcaccgattcgagctcgtcg
tcctcgccctag

DBGET integrated database retrieval system