KEGG   Nasonia vitripennis (jewel wasp): 100123613Help
Entry
100123613         CDS       T01081                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100123613
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100123613
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     100123613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 377 aa AA seqDB search
MSKFGSLSNGSMSMMSSRGGGSSSRGKSNLAVNIGQNNEMCLMAGRKETFANDPQMTFPG
QGVVRPNLIAGREDGSSDQFELGAYGYGKNNVKLLYVRRENALRHEIREYEIDVHLRLST
QKDYLVGDNRDIIATDSQKNTVYLMAKKHGVKSPEEFAIILCSHFLYQYRHVEEVNVRVE
EYPWSRHEVNGVSHNHAFVFTPTATRYCQVTQLRNESPRIRGGLKNLRVLKTTQSSFTDF
IQDDYRTLPDANDRIFSTVVTASWDFSTASGVDFDAVWRTVKNCILENFAGPPVSGVYSP
SVQNTLYLAERGVLSKVDQIFSIEMQMPNKHYFDIDLSKFSKLVPTENKEVYLPMDKPSG
IIYAQLNRKDFNTRSKL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaattcggttcgctgtccaacggctcgatgtcgatgatgagcagtcgaggcggc
ggaagctcgtctcgtggaaaatcaaatctcgccgtcaacataggccagaacaacgagatg
tgcttaatggccggaaggaaagaaactttcgctaacgacccacagatgacttttccagga
cagggcgttgtcaggcctaatcttatcgccggccgagaggacggaagcagcgatcaattc
gagctcggcgcctacggctacgggaagaacaacgtgaagcttctctacgtccgccgcgaa
aacgccctgcgccacgagatccgcgagtacgagatcgacgtgcatctgcgtctaagcaca
cagaaggattacctggtcggcgacaaccgggacatcatagctaccgacagccagaaaaac
accgtctacctcatggccaaaaaacacggtgtcaagtcgcccgaggaattcgccataatt
ctgtgctcgcacttcctctatcagtacagacacgtcgaggaggtgaacgtcagggtcgag
gagtatccctggagcagacacgaggtcaacggtgtgtcccacaatcacgcgttcgtgttc
acgcccaccgctacgaggtactgccaagtgacccagcttagaaacgagtcgccgaggatc
cgaggtggactgaagaacctgagggtgttgaagacgacccagagctcgttcacggacttt
atccaggacgattatcggactctgcccgacgcgaacgatcgcatcttcagcacagtcgtc
accgcctcctgggacttttccactgcttcgggggtcgatttcgacgcggtttggcgcaca
gtcaagaattgcatcctcgagaatttcgccggtccgccggtcagcggagtttactcgccg
agtgtgcagaatacgctctatctcgccgaaaggggagttctcagcaaggtcgatcagatt
ttcagtatcgaaatgcagatgccgaacaagcactacttcgacatcgatctgagcaagttc
tcgaaactggtgccaacggagaacaaggaagtttacctgccgatggacaagccctccggg
atcatctacgcgcagctgaataggaaagatttcaacacgaggtcgaagctttga

DBGET integrated database retrieval system