KEGG   Nasonia vitripennis (jewel wasp): 100123760Help
Entry
100123760         CDS       T01081                                 

Definition
group XV phospholipase A2-like
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:nvi00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:nvi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 408 aa AA seqDB search
MRLGSVSCLALLLFCCISLTQTFRFRGNQRSPVIFVPGDGGSQVEASVNKTTVVHYLCEK
VSSGFFNIWLNLELLVPIIIDCWIDNMKLLYNNETRKSRNPDGVDIKIPGWGDPFVVEYL
DPSKASPGAYFKDIANMLVKDLGYIRNVSLRGAPYDFRKGPNENDEYFVKLKDLVEETYI
MNNNQPVTLVAHSMGGPMSLIFLQRQSQKWKDKYINSLITLAGAWGGSVKALKVFAIGDN
LGAYLLRESILKDQQITSPSLGWLLPSKLFWKEDEVLVQTQLRNYTFADMRQYLIDINVP
NGWEFRKDNEKFQLDFRPPGVELHCLHGVKVDTVERLFYKPGISIDGYPQQIPGDGDGTV
NLRSLEGCTYWTNKQKQKIYHQPFPGVNHMQILSNGSVLDYIRNVLKF
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctggggtcggtgtcctgtttggctctgttgttgttctgctgcatatctctgaca
cagacttttcgattcaggggtaatcagcgatcgcctgttattttcgttcctggagatgga
gggagccaagttgaggcaagcgtcaacaaaactaccgttgtgcactacctgtgcgagaag
gtatcctctggattcttcaacatttggctgaacctggaactgctggttccgataattata
gactgctggatcgataacatgaaactgctgtacaacaatgagaccaggaaaagcaggaat
ccagatggagtggatatcaagataccgggctggggagatccttttgttgtggagtacttg
gatcccagtaaggcttcgcctggtgcttacttcaaagacattgccaatatgcttgtcaag
gatttaggatatattcgtaatgtatccctgaggggagcaccatacgactttagaaaagga
ccaaatgagaacgatgaatattttgttaaactgaaggaccttgtggaggaaacttatatt
atgaataataaccaacctgtcactctagtggcacacagcatgggagggccaatgtcgttg
atatttctacagcgccagagtcagaaatggaaagataaatatatcaattcattgataact
cttgctggtgcctggggaggatcagtcaaggcgctcaaagtatttgccattggtgacaat
ttgggagcttatctattgcgagaaagtatattaaaggatcaacagattactagtccaagc
cttgggtggttgctgccttcaaaattgttctggaaggaggatgaagtgcttgtgcaaact
cagttgcgaaattacacatttgctgatatgaggcaatacttgatagatataaacgtgcca
aatggatgggaattccgtaaagataatgaaaaattccaactagactttaggccaccaggt
gtagagctacattgtttacatggagtcaaagtggatacagttgaaagactattttacaag
cctggaatatcaatagatggatatccacaacaaataccaggggatggagatgggactgtc
aatttaaggagtttagaagggtgcacttattggactaacaaacaaaagcaaaaaatttat
catcaaccttttccaggagtcaatcatatgcaaattttgagcaatggttcggtgctggat
tacattagaaacgttttaaaattttaa

DBGET integrated database retrieval system