KEGG   Nasonia vitripennis (jewel wasp): 100123787Help
Entry
100123787         CDS       T01081                                 

Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100123787
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100123787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 485 aa AA seqDB search
MDALTFGSHRLVHIDLKGAPPRVSYFEKLFPLLRAWGATGLLLEWEDTFPYTRELSPIGS
NGPSSLSSGYTTQEAQQILQMAGDSGLAVMPLIQTFGHMEFVLKHDEWRSLREVAPFPSS
MCPSNPGAQSLVKSLIRQIVTFHPDIQYLHIGADEVWHLGLCPVCSKRASTSKHGKAGLF
LEHVLAVAQFIKETYPYLKIIMWDDILRSIDLQVLNEYYIGKYVEPMIWHYNARENFGLP
PDLWDKYSSVFPNIWAATAFKGATGSCQHIPTIRHHISNHERWLEELSAHVSKVNEFRGT
AFTGWSRYDHYATMCELLPTGIPSLAICLKVWLHGYNEQTYNQVSKSLGYIDHPLHITPQ
PRPVPIPNNLQFPGWQVAVGIEWFLNYKTKFHGLVNSEQLLTWMNPWQVANNYTNPMQLE
SLIPAFTDMLLELSSLENYMRVQMEIVFFNSMLDEWIGTNVQPLKDKLMKLKQTAENQIK
LNSRS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgctgacgtttggttcgcacaggttagttcacatcgatctcaaaggagcacct
ccgcgagtcagttattttgaaaagctatttccattgttacgggcatggggtgccactggg
cttttacttgagtgggaagatacatttccatacactagagagctttcgccaatcggcagc
aatggaccaagcagtttgtcaagtggttacacgactcaggaagctcagcaaattttgcaa
atggcaggagactccgggttagctgtgatgccacttattcagacttttggacatatggaa
tttgttctaaaacacgatgagtggaggtctttgagggaagtagctccttttcccagttca
atgtgtccatcaaatccaggagcgcagtctttagtgaaatctctgattaggcaaattgtt
acctttcatccagacattcagtacctgcacattggagcagatgaagtgtggcaccttggc
ctctgtcctgtttgtagcaagagagcaagtaccagcaaacatggcaaagctggtttgttt
ctggaacatgttctggcggtagcacaatttatcaaagagacttatccctacctcaaaatc
ataatgtgggatgatatactgcgatcaatagacttacaagttttgaatgaatattatatt
ggtaaatatgttgagccaatgatttggcactacaatgccagagaaaattttggactacca
ccagatttgtgggataaatacagctcggtgtttccaaatatatgggctgctacagctttc
aaaggagccacaggctcctgtcaacacattccaactatcagacatcacataagcaatcat
gagcggtggctagaagagctaagtgcacatgtgagcaaagtcaatgaattccgggggact
gctttcacaggctggtcaaggtatgaccattatgcaaccatgtgtgaacttttaccaaca
ggcattccatcattagcgatttgtttgaaagtctggttgcacggctacaatgaacaaacg
tacaatcaagtttcaaagagtctaggatacattgatcatcctctgcatataactccacaa
cccaggccagttccaataccaaataatttacaatttcctggctggcaagtggcagtgggg
atagagtggtttttaaactataagacgaaatttcacggacttgtaaatagcgaacaacta
cttacatggatgaatccctggcaagtcgcgaataactacaccaatccaatgcaactagag
agtctgattccggcattcacggacatgctgctggaattatcctcgctagagaactacatg
cgcgtccagatggaaatcgtcttcttcaattcgatgctggacgaatggataggcacaaac
gttcaacctcttaaggacaaattgatgaaattgaaacagactgcggagaatcagataaaa
ttaaacagtagatcgtag

DBGET integrated database retrieval system