KEGG   Nasonia vitripennis (jewel wasp): 100123787Help
Entry
100123787         CDS       T01081                                 

Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:nvi00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 485 aa AA seqDB search
MDALTFGSHRLVHIDLKGAPPRVSYFEKLFPLLRAWGATGLLLEWEDTFPYTRELSPIGS
NGPSSLSSGYTTQEAQQILQMAGDSGLAVMPLIQTFGHMEFVLKHDEWRSLREVAPFPSS
MCPSNPGAQSLVKSLIRQIVTFHPDIQYLHIGADEVWHLGLCPVCSKRASTSKHGKAGLF
LEHVLAVAQFIKETYPYLKIIMWDDILRSIDLQVLNEYYIGKYVEPMIWHYNARENFGLP
PDLWDKYSSVFPNIWAATAFKGATGSCQHIPTIRHHISNHERWLEELSAHVSKVNEFRGT
AFTGWSRYDHYATMCELLPTGIPSLAICLKVWLHGYNEQTYNQVSKSLGYIDHPLHITPQ
PRPVPIPNNLQFPGWQVAVGIEWFLNYKTKFHGLVNSEQLLTWMNPWQVANNYTNPMQLE
SLIPAFTDMLLELSSLENYMRVQMEIVFFNSMLDEWIGTNVQPLKDKLMKLKQTAENQIK
LNSRS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgctgacgtttggttcgcacaggttagttcacatcgatctcaaaggagcacct
ccgcgagtcagttattttgaaaagctatttccattgttacgggcatggggtgccactggg
cttttacttgagtgggaagatacatttccatacactagagagctttcgccaatcggcagc
aatggaccaagcagtttgtcaagtggttacacgactcaggaagctcagcaaattttgcaa
atggcaggagactccgggttagctgtgatgccacttattcagacttttggacatatggaa
tttgttctaaaacacgatgagtggaggtctttgagggaagtagctccttttcccagttca
atgtgtccatcaaatccaggagcgcagtctttagtgaaatctctgattaggcaaattgtt
acctttcatccagacattcagtacctgcacattggagcagatgaagtgtggcaccttggc
ctctgtcctgtttgtagcaagagagcaagtaccagcaaacatggcaaagctggtttgttt
ctggaacatgttctggcggtagcacaatttatcaaagagacttatccctacctcaaaatc
ataatgtgggatgatatactgcgatcaatagacttacaagttttgaatgaatattatatt
ggtaaatatgttgagccaatgatttggcactacaatgccagagaaaattttggactacca
ccagatttgtgggataaatacagctcggtgtttccaaatatatgggctgctacagctttc
aaaggagccacaggctcctgtcaacacattccaactatcagacatcacataagcaatcat
gagcggtggctagaagagctaagtgcacatgtgagcaaagtcaatgaattccgggggact
gctttcacaggctggtcaaggtatgaccattatgcaaccatgtgtgaacttttaccaaca
ggcattccatcattagcgatttgtttgaaagtctggttgcacggctacaatgaacaaacg
tacaatcaagtttcaaagagtctaggatacattgatcatcctctgcatataactccacaa
cccaggccagttccaataccaaataatttacaatttcctggctggcaagtggcagtgggg
atagagtggtttttaaactataagacgaaatttcacggacttgtaaatagcgaacaacta
cttacatggatgaatccctggcaagtcgcgaataactacaccaatccaatgcaactagag
agtctgattccggcattcacggacatgctgctggaattatcctcgctagagaactacatg
cgcgtccagatggaaatcgtcttcttcaattcgatgctggacgaatggataggcacaaac
gttcaacctcttaaggacaaattgatgaaattgaaacagactgcggagaatcagataaaa
ttaaacagtagatcgtag

DBGET integrated database retrieval system