KEGG   Nasonia vitripennis (jewel wasp): 100123789Help
Entry
100123789         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100123789
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100123789
Transcription machinery [BR:nvi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100123789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 513 aa AA seqDB search
MSDHGCIHLNNFKAAKGIQPYKVIHSFFVTSTSNEARVRKAVSCLCHTCKTYKDRLHSCL
HCIFFGCYVKGHIQEHAKTKKHFLAVDLCYGNILCFQCGDYVYDRELLSVAKAQWSETAK
SLSLGEFYRTWEPSVNEVELLRKNPRRRRVVENSTIGLRGLINLGSTCFMNCIVQALIHT
PLLRDYFLADRHHCPQPNRCLVCEVSSLFQEFYSGNKAPLILHKLLHLIWTHARHLAGYE
QQDAHEFFIATLDVLHRHCEQYSQAAPLIVKDNPHHCNCIIDQIFTGGLQSDVVCQACNG
VSTTIDPFWDISLDLGPAAVSSSTSGMANDGSSAPTSLLDCLERFTRAEHLGSSAKIKCN
NCQTYQESTKQLTMKQLPIVASFHLKRFEHSSIQDKKISTFISFPEQLDMTPFMSHRRNG
NNNSSSVAPTGLHKNGEDPAFSDNRYSLFAVINHEGSLETGHYTAFIRQQRDQWFKCDDH
LITRARLKDVLTSEGYLLFYHKQILEYGRNSKV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccatggctgcatacacttgaataacttcaaagcagccaagggcatacagccc
tacaaagtcattcactcgtttttcgtcacgagcacgtccaacgaggcgcgcgtcaggaag
gctgtgagttgtctctgtcacacatgcaaaacctacaaggaccgtctgcactcgtgcctg
cactgcatcttcttcggttgctacgtcaagggccacatccaggaacatgcgaaaacgaaa
aagcactttctcgcggtggacctgtgctacgggaacatcttgtgtttccaatgcggcgac
tacgtgtacgaccgtgagctgctcagcgtagccaaggctcagtggagcgagactgcgaaa
tccctcagtctcggcgaattctacaggacgtgggagccgtcggtcaacgaggtcgagctg
ctcaggaagaacccgcgcaggaggcgggtcgtcgagaattccactataggtctacgcggt
ctgataaacctgggcagtacttgcttcatgaactgcatagtccaggcgctgatccacacg
ccgctgctgcgcgactacttcctggccgataggcaccactgcccgcagccaaaccgctgc
ctcgtctgcgaggtctcgagtctcttccaggagttctactcgggtaacaaggcgccgctg
atcctgcacaagctgctccacctcatctggacgcacgctcgccacctcgccggatacgag
caacaggacgcccacgagttcttcatcgccaccctggacgtgctgcacaggcactgcgag
cagtactcgcaagcggcgcctctcatcgtcaaggacaatccgcaccactgcaactgcatc
atcgaccagatattcactggaggcttgcagagcgatgtcgtctgtcaggcttgcaacggt
gtgtcaacaacgatcgatcccttctgggacatctcgctcgatctgggccccgccgccgtg
agcagctcgacctccggcatggccaacgacggctcgagcgcgccaacttccctcctcgac
tgcctcgaacgatttacacgggccgagcacctcggctcctcggccaaaattaaatgcaac
aactgccaaacctaccaggagagcacgaagcaactcacgatgaagcagctcccgatcgtc
gcaagctttcatctcaagcgtttcgagcactctagtattcaagataaaaagatctcgacg
ttcatctcattcccagagcaactcgatatgacgcccttcatgtcgcatcggagaaacggc
aacaacaacagcagcagcgtagccccaactggtttgcacaaaaatggagaggacccggct
ttcagtgacaacaggtactctctcttcgcggttataaatcacgagggctcgctcgagact
ggacattacactgctttcatacgacagcaacgcgaccaatggttcaaatgcgatgatcac
ctcatcacgagggccagattgaaagacgttttgacgagcgaaggctatttactgttctac
cacaagcagatcctagagtacggccgaaatagcaaagtgtga

DBGET integrated database retrieval system