KEGG   Nasonia vitripennis (jewel wasp): 100124035Help
Entry
100124035         CDS       T01081                                 

Definition
ubiquitin specific peptidase
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100124035
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100124035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 353 aa AA seqDB search
MGANISQLERDIGSDQFPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKARNK
RTKETLLTCLADLFHSIATQKKKVGSIAPKKFIARLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNQSKPAGGKGAGDAGTPPEPTWVHEIFQGILTSETRCLNCETVSSKDEDF
FDLQVDVDQNTSITHCLKCFSNTETLCSDNKFKCDHCSSYQEAQKRMMLKKLPMILALHL
KRFKYVEQYNRHIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLVAVVIHCGSGPNRGHYI
SIVKSHGFWLLFDDDMVDKIDSSTIEDFYGLTSDIQKNSETGYILFYQSRDCS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccaatatatctcaattggaaagggatattggctccgaccaatttccccctaat
gaacattactttggattagttaattttggcaatacgtgttatagcaattcagttttgcaa
gccttgtacttttgtcggccttttagagaaaaagttttagaatacaaagctagaaataaa
cgtaccaaagaaacccttctaacatgtttggcagacttgtttcacagtatagcaacgcag
aagaagaaagttggttcaatagcaccaaaaaagtttatagctcgactaagaaaagaaaaa
gaggaatttgacaattacatgcagcaagatgctcatgaatttttgaacttccttataaat
catataaatgaaattatattagctgagagaaatcagagtaaacctgctggaggaaaaggt
gcaggtgatgctggcacaccaccagaacctacgtgggtacatgaaattttccagggcatt
ctgacttcagaaactcgttgccttaattgtgagactgtttctagcaaggatgaggatttc
tttgatcttcaagttgatgttgatcagaatacttcaattacccactgcctcaaatgtttc
tcaaacacagaaacactctgtagtgacaacaagtttaaatgtgatcactgcagtagctat
caagaagctcagaaacggatgatgctgaaaaaactaccaatgattcttgctttacattta
aaaaggtttaaatatgttgaacagtataataggcacattaaagtttcacacagggtagtt
tttcctctagaacttcgactttttaatacaagcgatgatgcagtaaatccagatcgttta
tatgatctagtggctgtagttatccattgtggaagtgggcctaatagaggacattacatt
tctatagtcaagagccatgggttctggttactcttcgatgatgacatggttgacaaaatt
gattcgtccactatagaagatttttatgggttgacatcagatatccagaaaaattcagaa
actggatacattttgttttatcaatcaagagactgcagttaa

DBGET integrated database retrieval system