KEGG   Nasonia vitripennis (jewel wasp): 100124191Help
Entry
100124191         CDS       T01081                                 

Definition
serine/threonine-protein kinase Doa-like
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100124191
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100124191
Spliceosome [BR:nvi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100124191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 565 aa AA seqDB search
MLWAYLNICRNFFNRWLLGQVNMPRSRRRHRSRSHSRTHSPASPQYDHKRRRVDYESPPR
KGTYSGERVLRSRQHERGTSQERRYKRSHRRSPSSGRQQHSSHAGQQQHRERERERDRDR
ERERDKPDKQSAQAGGLTSSSKYSSSSNSAKLAAVQAAQAGSAQAAATAAYSPKRESNRH
KPTSNKSQSPRAPSVEDDEDGHLVYHSGDVLANRYKVLATLGEGTFGKVVKVKDLQMDHV
MALKIIKNVEKYREAARLEINALEKIAAKDPEGQHLCVKMLDWFNYHGHMCIAFEMLGLS
VFDFLRDNDFQPYPLDHVRHMGYQLCYAVKFLHDNKLTHTDLKPENILFVDSAFDLVYNS
KKKTVPSKRKDVRIVKRTDIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWAQPCD
VWSIGCILFELYLGITLFQTHDNREHLAMMERILGTIPHRMARKTKIKYFYHGKLDWDDK
SSAGRYVRDYCKPLHRYLLSDDEDHKQLFDLIQKMLNYEPSSRITLKEALAHPFFDALPA
SQRLTDPRAAGDSQQSHERSHSLSR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgggcctatttgaacatctgcaggaacttctttaatcgttggttactcggacag
gtgaacatgccacgaagcaggagacgtcatcgctcgcgaagccactcacgaacacattca
ccggcttcaccacaatatgaccataagagaagaagggttgattacgaaagtccaccacgt
aaaggaacatacagtggcgagagggtcctgcgatctcgccagcacgagcgaggcaccagc
caggagcggcgctacaagcgctcgcatcgtcgttcgccgagcagcggccgtcaacagcac
agctcccatgcgggccaacagcagcaccgggagcgcgagcgggagcgcgaccgggaccgg
gagcgcgaacgcgacaagcccgacaagcagtcagcccaagcaggtggcctgacctcaagc
agcaagtacagcagcagcagcaactcggccaaactggcggccgtacaggctgcgcaggcc
ggctcggcccaggctgccgcgaccgcagcctactcgcccaagagggagtccaacaggcac
aagcctacgtccaataagagccagagcccacgagcgccctccgtcgaggacgacgaagac
ggccacctcgtttaccattctggcgacgtcctggcgaatagatataaagtactggccacc
ctaggagagggtacttttggaaaggttgtcaaggttaaggacttgcaaatggatcatgtg
atggcactgaagatcatcaagaacgtggagaagtaccgagaggccgccagactagagatc
aacgctctggagaagatcgcggcgaaggatcccgaggggcaacacttgtgcgtcaagatg
cttgactggttcaactaccatggccacatgtgcatcgctttcgaaatgcttggactcagt
gtcttcgatttcttgagggacaacgacttccaaccctacccgctggatcacgttagacac
atgggttaccaactgtgctacgcagtgaaattcctacacgacaacaaactgacacacaca
gacctgaaacctgaaaacattttattcgtcgattctgcattcgaccttgtctacaatagt
aaaaaaaagactgttccttctaagcgaaaggacgtgagaatagtcaaaaggacggacatt
cgactgattgattttggcagcgctaccttcgaccatgagcaccacagcactatcgtcagt
acaaggcactacagggcaccagaagtaattttagaattaggatgggcacagccttgtgat
gtatggtcgatcggctgcatcctctttgaattatacctgggcataactctattccaaaca
cacgacaatcgcgagcatctcgcgatgatggaacgcatcctcggtacgataccacacaga
atggcccgcaaaaccaaaatcaagtacttctaccacggcaagctcgattgggatgacaag
agttccgctggcagatatgtccgtgactattgcaaaccgctgcatagatatcttttatca
gacgacgaggatcacaagcagctgttcgacctaatccagaagatgctaaactacgagccg
tcgtcgcgcatcacacttaaagaagccctagctcaccccttctttgatgcgcttcccgcg
agtcagcgactgacggatccgcgcgccgccggtgactcccagcagtcgcacgaacgctcg
cactcactctcacgatga

DBGET integrated database retrieval system