KEGG   Nasonia vitripennis (jewel wasp): 100124237Help
Entry
100124237         CDS       T01081                                 

Definition
OTU domain-containing protein 5-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 586 aa AA seqDB search
MTILSKKKQSTNKDRRGESSSNSEVDVHGVQNDHGAAGSIALPNAPYQVRSNNAFAVEFG
SSVQAEHNSGSIVLTANGSYEGNVDRREEKHFDESGSSSHGKRHRRRASPHRNSRNKRER
ERERGRGAVASNVGNVTDRERERDHERQSTPPIASSSNSGLQGGDSAVMSNSRMAIAAAA
ANLEHELANGYNSGDEYTGRTGNNLTLAEWQERDRWFEKRLRKLGFIVKKMGEDGACLFR
AVADQVYGDQEMHGVVRKHCMDYIAANQEFFSHFVAEDFSTYVDRKRQEYVHGNHIEMQA
MSEMYNRSVELFCYSTEPINIFHGINKSDNEPIRLSYQRGSHYNSIVNPYKATIGVGLGL
PSFNPGSADRELISDAVRQSEELHIEQTMLEDKIKATDWEATNEAIEEQVARESYLQWLR
DNEMRKARSASSSSTSTVTSSQNNHFHSHSSRAAQQRSHCASPTSSQPNQESLRNSPKTN
DSMRYNKRSPQHQSSSGIPLLPSEYKAKPPVPQEPVPGSSKEMHTAPDVSLFNRLPPEVF
GLTDWEDSDILSKVLATSQQEYLDSLKQSHTTSVSDSNDTKDSANS
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctctcgaaaaagaaacagagcacgaacaaggacaggcgtggcgagagctcg
tcaaactccgaggtcgacgttcacggagtccagaacgatcatggcgcagctggatccatt
gccttgcctaatgctccctatcaggtacgctccaacaatgcctttgcagttgagtttggt
tcttccgttcaggctgagcacaattctggctcgatagtcttaactgccaatggctcctat
gagggcaatgttgatcgtcgagaggagaaacattttgacgaaagtggaagttctagccat
ggcaaaagacatcgcagacgagcaagtcctcatagaaattcacgaaataaacgagaacga
gaaagggaaagaggacgtggtgcagtcgctagtaatgttggtaatgtcacagaccgtgaa
agagaaagggatcatgagagacaatctacaccacccattgcttccagcagtaacagtgga
ctacaaggtggggacagcgcagtcatgtcaaacagccggatggctattgctgccgcagct
gcaaatcttgagcatgagttagctaatggatataatagtggtgatgaatacactggaaga
acaggaaacaatctgacacttgcagaatggcaagagcgtgacagatggttcgaaaaaaga
ttaagaaaattgggcttcattgtgaaaaaaatgggagaagatggtgcatgcctttttagg
gctgtggctgatcaagtatatggcgatcaagaaatgcatggagtagttcggaaacattgt
atggattatattgctgccaaccaggaatttttttcacactttgttgctgaggattttagc
acatatgttgatagaaaaagacaggaatatgttcatgggaatcacatagaaatgcaagca
atgtcagaaatgtataatcgaagcgttgaactgttttgttacagtactgagccaataaat
atctttcatggcataaacaaaagcgataatgagcctataagattgtcttatcaaagaggt
agtcattacaacagtattgtcaacccatacaaagcaaccattggcgtggggcttggatta
ccatcttttaatcctggatcagctgatcgagaattaatttccgatgctgtcagacaaagt
gaagagttgcacatagaacagacaatgcttgaggacaaaattaaagctacagattgggaa
gctaccaacgaagcaatcgaagaacaagtagctagagaaagttacttgcagtggctacga
gataatgaaatgaggaaagctagatctgcaagcagtagcagtacaagtacagtaactagt
tctcaaaataatcattttcattctcacagtagtagagcagcacagcaaagaagtcattgt
gcttctcctacatcaagtcaacccaatcaagaatctttacgaaattcacccaagactaat
gacagtatgcgatataataagagatcaccacagcatcaatcaagttctggaatcccactt
cttccatctgaatataaagctaaaccacctgttcctcaagaaccagttccaggtagtagc
aaagaaatgcatacagcaccggacgtttcactatttaatcgtcttcctccagaagtgttt
ggtttaactgattgggaagacagtgatattctatcaaaggtactcgcaacttcacaacaa
gaatatttagatagtttaaagcaatcgcacactacttctgtgagcgattccaacgacaca
aaagattcggcgaatagttga

DBGET integrated database retrieval system