KEGG   Nasonia vitripennis (jewel wasp): 100124237Help
Entry
100124237         CDS       T01081                                 

Definition
OTU domain-containing protein 5-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100124237
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100124237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 586 aa AA seqDB search
MTILSKKKQSTNKDRRGESSSNSEVDVHGVQNDHGAAGSIALPNAPYQVRSNNAFAVEFG
SSVQAEHNSGSIVLTANGSYEGNVDRREEKHFDESGSSSHGKRHRRRASPHRNSRNKRER
ERERGRGAVASNVGNVTDRERERDHERQSTPPIASSSNSGLQGGDSAVMSNSRMAIAAAA
ANLEHELANGYNSGDEYTGRTGNNLTLAEWQERDRWFEKRLRKLGFIVKKMGEDGACLFR
AVADQVYGDQEMHGVVRKHCMDYIAANQEFFSHFVAEDFSTYVDRKRQEYVHGNHIEMQA
MSEMYNRSVELFCYSTEPINIFHGINKSDNEPIRLSYQRGSHYNSIVNPYKATIGVGLGL
PSFNPGSADRELISDAVRQSEELHIEQTMLEDKIKATDWEATNEAIEEQVARESYLQWLR
DNEMRKARSASSSSTSTVTSSQNNHFHSHSSRAAQQRSHCASPTSSQPNQESLRNSPKTN
DSMRYNKRSPQHQSSSGIPLLPSEYKAKPPVPQEPVPGSSKEMHTAPDVSLFNRLPPEVF
GLTDWEDSDILSKVLATSQQEYLDSLKQSHTTSVSDSNDTKDSANS
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctctcgaaaaagaaacagagcacgaacaaggacaggcgtggcgagagctcg
tcaaactccgaggtcgacgttcacggagtccagaacgatcatggcgcagctggatccatt
gccttgcctaatgctccctatcaggtacgctccaacaatgcctttgcagttgagtttggt
tcttccgttcaggctgagcacaattctggctcgatagtcttaactgccaatggctcctat
gagggcaatgttgatcgtcgagaggagaaacattttgacgaaagtggaagttctagccat
ggcaaaagacatcgcagacgagcaagtcctcatagaaattcacgaaataaacgagaacga
gaaagggaaagaggacgtggtgcagtcgctagtaatgttggtaatgtcacagaccgtgaa
agagaaagggatcatgagagacaatctacaccacccattgcttccagcagtaacagtgga
ctacaaggtggggacagcgcagtcatgtcaaacagccggatggctattgctgccgcagct
gcaaatcttgagcatgagttagctaatggatataatagtggtgatgaatacactggaaga
acaggaaacaatctgacacttgcagaatggcaagagcgtgacagatggttcgaaaaaaga
ttaagaaaattgggcttcattgtgaaaaaaatgggagaagatggtgcatgcctttttagg
gctgtggctgatcaagtatatggcgatcaagaaatgcatggagtagttcggaaacattgt
atggattatattgctgccaaccaggaatttttttcacactttgttgctgaggattttagc
acatatgttgatagaaaaagacaggaatatgttcatgggaatcacatagaaatgcaagca
atgtcagaaatgtataatcgaagcgttgaactgttttgttacagtactgagccaataaat
atctttcatggcataaacaaaagcgataatgagcctataagattgtcttatcaaagaggt
agtcattacaacagtattgtcaacccatacaaagcaaccattggcgtggggcttggatta
ccatcttttaatcctggatcagctgatcgagaattaatttccgatgctgtcagacaaagt
gaagagttgcacatagaacagacaatgcttgaggacaaaattaaagctacagattgggaa
gctaccaacgaagcaatcgaagaacaagtagctagagaaagttacttgcagtggctacga
gataatgaaatgaggaaagctagatctgcaagcagtagcagtacaagtacagtaactagt
tctcaaaataatcattttcattctcacagtagtagagcagcacagcaaagaagtcattgt
gcttctcctacatcaagtcaacccaatcaagaatctttacgaaattcacccaagactaat
gacagtatgcgatataataagagatcaccacagcatcaatcaagttctggaatcccactt
cttccatctgaatataaagctaaaccacctgttcctcaagaaccagttccaggtagtagc
aaagaaatgcatacagcaccggacgtttcactatttaatcgtcttcctccagaagtgttt
ggtttaactgattgggaagacagtgatattctatcaaaggtactcgcaacttcacaacaa
gaatatttagatagtttaaagcaatcgcacactacttctgtgagcgattccaacgacaca
aaagattcggcgaatagttga

  All links  
No link information was found.   
DBGET integrated database retrieval system