KEGG   Nasonia vitripennis (jewel wasp): 100187737Help
Entry
100187737         CDS       T01081                                 

Gene name
Gemin7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100187737 (Gemin7)
Spliceosome [BR:nvi03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    100187737 (Gemin7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 112 aa AA seqDB search
MPNSNSSSSSANDEVKEELRSVAEAAANEFATPDKQEARAFLRERFLRVITGIVGKPAKF
HLYENTSVTAEFRGCDIDFLELYVRNLTTPLGTIPEAVLRTNDVILLEMEKV
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgcctaactctaattcaagttcctcgtctgccaatgatgaagtaaaggaagaactgaga
tcagttgcagaagctgctgccaacgaatttgcaacccccgacaagcaggaggcgcgagct
tttttacgagaaaggttcctgcgtgtaattaccggcattgtgggtaagccagcaaagttt
cacctatatgagaatactagcgtcactgctgaattccgaggctgtgatatcgattttttg
gaactatatgtcagaaacttgaccaccccattaggtacaattccagaggctgtactgaga
accaatgatgttatccttttagaaatggaaaaagtgtga

DBGET integrated database retrieval system