KEGG   Nasonia vitripennis (jewel wasp): 100216456Help
Entry
100216456         CDS       T01081                                 

Definition
ubiquitin specific protease-like
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    100216456
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100216456
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100216456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 689 aa AA seqDB search
MTVLEAEEDTDERPNPPRKKLCLSLSALSERRNQGISKNKSEPQPVGRASTSQIRPNHPS
SSKMLNDFQRLGSNHRDAGCDVTSNVITGGLRIATLCNLGNTCFLNSVLYTLRCTPSFLH
NLHHLATDLSIVSEKQLQTKIKISSLGRTGISSTTSSSRSWSNKDLPSLTSASAATELNK
PRIQVATEKLHELFMSLRELETRENNEPYQPDAFLQALREVNPIFEGNQQQDAHELLVCL
LDNIRETFQLLVRHRENQFGWRADGNGGTGTATQIDFLRDRATQSESSKRGNRKSQKQKK
KLTGSSLRASSASGIIQTTLNGIKPPVGQVLENGSITPPISNGELSSRLESKKCFISEDF
EGVSLLRTTCLECEQVTERKETFCDICVPIDIDRSNEKDEDGKTMDCSAIYKKAVVTSEL
LFDKNKYWCATCLRYNEARRAVCFPSLPRLLVLQLKRFSTAAGSMEKINNHMPTPLTLQC
FCEECNIIADQSRYSGSFSGSSQSNQKEPTQRHVYNLYSVIMHQGATMTAGHYVAYTRVP
GESAHAEYKECEGDILHRQQNSQQQNHHSSSAHHNGHQGSDNSKITYFFSCFGNKPNVNE
NKDSAQRGKQQQGCRGNECCGIKQTSRNGTGTWLECDDEAVRVIPERELQDKLAPSSRNS
STPYLLFYVRSTTSAPTSTTTATATTMTT
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgacagtattagaagcagaggaggatactgatgaacggccgaacccaccaaggaagaaa
ctttgcctctctctttcggctttgtcagagagacgcaatcaaggaatcagcaaaaacaaa
tctgagcctcagccagttggacgggctagtactagccaaatacgtcccaatcatccaagt
tcaagcaaaatgttgaatgatttccaaaggctaggtagtaatcatcgagatgctggctgt
gatgttacatcaaacgtcataactggaggcttaagaatagcaactttgtgtaatttaggc
aatacctgctttttgaatagtgtactttatacgctgcgatgcacaccatctttcttacac
aaccttcaccacctagccacagatttatctattgtcagtgaaaaacaacttcaaacaaaa
attaagatatcatctttgggtagaactggtatatcaagtacaacaagtagtagtcgtagc
tggagcaacaaagatctcccatcattgacatccgcaagtgctgcaacagaattgaataag
cctcgaattcaagtagccactgaaaagttgcatgagcttttcatgtcattaagagaatta
gaaacgagagaaaacaatgaaccttatcagcctgatgcatttttacaagctcttagagaa
gtcaatccaatattcgagggcaaccagcagcaagatgcgcacgagttgctcgtctgtctt
ctcgataacatccgcgagacgttccaactgctcgtcaggcatcgagaaaaccagttcggc
tggcgggccgatggcaacggtggcactggtaccgccacgcagatcgacttcctgcgagat
cgagcgactcaatcagaaagcagcaagcgcggaaatcgtaagtcgcagaagcaaaagaag
aagctgacaggcagctcgctgcgagcctccagtgccagcggtatcatacaaacaacctta
aacggcatcaaaccgcctgtgggtcaagtgctagagaacggcagtattacgccgcctatc
agcaacggcgagttgagcagtcgactcgagagcaaaaagtgctttatttcggaggacttc
gagggtgtcagtcttctacgtaccacgtgcctggagtgtgagcaagttaccgagaggaag
gagaccttctgtgacatctgcgtgcccatcgacattgataggtcgaacgagaaagatgag
gatggaaaaacgatggattgtagcgcaatttataaaaaagcagtagtgacaagcgaactg
ttatttgataaaaacaaatattggtgtgccacatgtcttcggtacaatgaagctagacga
gccgtttgttttccttcattaccgagattgcttgttctacaattgaaaaggttttccact
gcagcagggtcaatggagaaaattaataatcacatgccaacgccactaaccctccaatgt
ttctgcgaagagtgcaacatcattgccgatcagtctcgttactctggttcattttcaggc
tcctcgcagagcaatcaaaaagaacctacccagcgtcacgtttataatctgtactccgtg
ataatgcatcaaggcgcaacgatgacagctggacactacgttgcctatacacgtgtacct
ggcgaatcagctcacgctgaatataaggagtgtgagggtgatattcttcatcgtcaacaa
aattctcagcaacagaatcatcattcgtccagtgctcatcacaatggtcatcagggttcc
gacaacagtaagatcacgtatttctttagctgtttcggcaacaagcctaacgtgaacgaa
aataaagattcggcgcaacgaggcaaacagcagcaaggttgccgaggcaatgagtgctgc
ggcattaagcaaacttcgcgtaacgggactggcacctggcttgagtgcgatgacgaggcc
gtacgcgtgattccagagcgcgaacttcaggacaaacttgcaccgagctcgaggaattct
agcacgccctacctgttgttttatgtgaggtctaccacatcggcgcctacgtcaacaaca
acagctacggcgacgactatgacgacttga

DBGET integrated database retrieval system