KEGG   Nasonia vitripennis (jewel wasp): 100328539Help
Entry
100328539         CDS       T01081                                 

Gene name
Pka-C1
Definition
cAMP-dependent protein kinase 1
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100328539 (Pka-C1)
   04340 Hedgehog signaling pathway
    100328539 (Pka-C1)
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100328539 (Pka-C1)
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100328539 (Pka-C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 353 aa AA seqDB search
MGNNATSSNKKVDAAESVKEFLEQAKEEFEDKWKKNPTNTAALEDFDRIKTLGTGSFGRV
MIVQHKPTKEFYAMKILDKQKVVKLKQVEHTLNEKRILQAINFPFLVSLRFHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHFLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYDKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSELKDLLRSLLQVDLTKRFGNLKAGVNDIKGHKWF
ASTDWIAVFQKRIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaatgccacgagctcgaacaagaaggtggacgccgctgaaagcgtcaaggag
ttccttgagcaggccaaggaggagttcgaggacaagtggaagaagaacccgaccaacacc
gcggccctcgaggacttcgacaggatcaagaccctgggcactggctcctttggcagggtc
atgatagtccagcacaagcccaccaaggagttctacgccatgaagatactggacaagcag
aaggtcgtcaagctcaagcaggtcgagcacaccctcaacgagaagaggatcctgcaggcc
ataaactttcccttcctcgtctctctgcgctttcactttaaggataattcgaatctctac
atggtgctggagtacgtgcccggcggagagatgtttagccatttaagaaaggtcggcaga
ttctcagagccccactccaggttctacgccgcccagattgtcctggcgtttgagtacctg
cacttcctcgacctcatctacagagatctgaaacccgagaatctcctcatcgactcacag
ggttacctcaaggtcacagactttggctttgccaagcgagtcaagggcaggacgtggact
ttgtgcggcacgcctgagtaccttgcacccgaaatcattctcagcaagggatacgacaag
gcggtggactggtgggccctgggtgtcctggtctatgaaatggctgcaggctatccgccc
ttcttcgccgaccagccaattcaaatctacgagaagatagtcagtgggaaggttcgtttt
ccctcgcactttggctccgagctcaaggatcttctgcgcagcctgctccaggtggatctg
accaagaggttcggcaatctcaaggctggagtcaacgacatcaagggacacaagtggttc
gccagcaccgactggatcgcagtcttccagaagcgaattgaggcgcccttcatacccagg
tgcaaaggacccggggacactagtaattttgacgattacgaggaggaggcattgagaatc
tcgtcaacggagaagtgcgccaaggagtttgctgaattttga

DBGET integrated database retrieval system