KEGG   Nasonia vitripennis (jewel wasp): 100498674Help
Entry
100498674         CDS       T01081                                 

Gene name
Usp7
Definition
ubiquitin carboxyl-terminal hydrolase 7 (EC:3.4.19.12)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100498674 (Usp7)
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100498674 (Usp7)
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100498674 (Usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1109 aa AA seqDB search
MNHVNDPDNIQQLNLATIQVDEIEEMDTQEEIPNDGQEIRPLNGDPELTCVTQDQDMEED
EARSEATFRYTVESVSKMKDSQLSPPCFVRNLPWKIMVMPRSSQTQERQPQRSLGFFLQC
NGESESSSWSCYATAELRLLSCKDGQDPFSRKIQHLFYSKENDWGFSHFMTWQDVLDPEK
GYIKDDAITLEVHVVADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNQLRKA
VYKMPTESDDFSKSVALALQRVFHELQFCDKPVGTKKLTKSFGWETLDSFMQHDVQEFLR
VLLDKLESKMKGTCVEGTVPKLFEGKMVSFIKCKNIDYTSKRVETFYDIQLNIKGKKNIY
ESFNDYVSTEILDGDNKYDAGEHGLQEAEKGVIFSSFPPVLHLHLMRFQYDPITDCSVKF
NDRFEFYEKISLGQYLKSSKELTNADYTLHAVLVHSGDNHGGHYVVFINPSGDGKWCKFD
DDVVSECSKQETIKHNYGGQDEDISMTVKHCTNAYMLVYIQNSKLEHVLQEVREENIPQE
LVERLREEKRLQHIKRKERNEAYLFMTVNVLFEDSFNGHQGNDLYDQEKALYRVFRVRKQ
ASLLEFLEILSESLKYSIGQIRIWPFSLRSNQTCRPTLIESETDLQKPITDCAESGNPWN
IFVELAAPDSGLTALPAFDKDTDVLLFFKLYDPKKRKIHYCGHHYMPVTAKVQDLIPILN
ERAGYPENTDIILYEEIKPNMVEKIDNLAEPLEKVLEELMDGDIIVFQREEKENDIYELP
TCRDYFRDLSFRMEVTFCDKTVPNDPGFLMELSQKITYEQMAKAVSQRLGTDPYLLQFFK
CQNYKDLPGNPLKCTFDGTLKELVANCKPKTKKIFYQQLSIHVNELENKKQFKCIWVNLT
LKEEKEIILYPNKNGTVLNLLEEAKKLVELSENGSGKLRILEIVSNKLQPEPKEDVPLES
LSTNGSKIYRIEEIPKDELNLSEDEILVPVAHFHKDVFSTFGIPFFFKIKHGEPFLQMKE
RLFKRLDIQEKEFEKFKFAIVTANKPHFINDSPDYCMDIGDFRPHQNQIFPLFNSGANQQ
KPWLGLDHINKAPKRNRINYLEKAIKIYN
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgtgaatgatccagataatattcaacaattgaacctggctacaatacaggtt
gatgaaatagaagaaatggatactcaagaagaaataccaaatgatggacaagaaattcga
ccattaaatggtgatcctgagttgacctgtgtaacacaagaccaagatatggaagaagat
gaggctagatcagaagcaacttttcgctatacagtagagagcgtttcaaaaatgaaagat
tctcaattatcccctccatgttttgttagaaatttaccttggaaaattatggtaatgcca
agatcaagtcaaacacaagaaaggcagccgcagagatctttaggtttttttttacaatgt
aatggagaaagtgagtcatcttcttggagctgttacgcaactgccgaattacgtttactc
tcctgtaaagatggacaggatccgtttagtagaaaaattcaacatcttttctatagtaaa
gaaaatgactggggatttagtcacttcatgacgtggcaagatgttcttgatccagaaaaa
ggttatatcaaagatgatgcaataactcttgaagttcatgtcgtagccgatgcacctcac
ggtgttagctgggatagtaaaaagcatactggatatgtcggattgaaaaatcaaggtgca
acgtgttacatgaactcgctacttcaaactctgtatttcacaaatcagttacggaaagcc
gtgtataaaatgccaacagaaagtgatgattttagtaaaagtgtagccttagcgttgcaa
agagtttttcatgaattgcagttttgtgataaaccagttggaaccaaaaaactaactaaa
agcttcggttgggagacattagactcatttatgcaacacgatgttcaggaatttttacgc
gtgcttcttgataaattagaaagtaaaatgaaaggaacctgcgtggaaggaacagttcca
aaattatttgaaggtaaaatggtttcttttatcaagtgtaaaaatattgactatacttca
aaaagagtggaaacgttttacgacatacaattgaacattaaaggaaaaaaaaatatttac
gaatcgttcaatgattatgttagtacagaaattttagatggagataataaatatgatgcc
ggtgagcatggacttcaagaggctgaaaaaggagtaatattttcttctttcccgccagtt
ttacacttgcatctaatgagatttcagtacgatccaattacagactgttctgtaaaattt
aatgataggtttgaattttatgaaaaaatcagtttagggcagtatttgaaaagtagtaaa
gaacttacaaatgctgactatactttacatgctgttttggtacacagtggtgataatcat
ggaggacattatgttgtatttatcaacccttccggagatggaaagtggtgtaaattcgat
gatgacgttgtttcagaatgttccaaacaagaaacaataaagcataactatggtggtcaa
gatgaagatatttcaatgactgtaaaacattgtacaaatgcatatatgttagtgtacatt
caaaattcaaaattagagcatgttttacaagaagttcgtgaagaaaatattcctcaagag
cttgttgaacgacttcgagaagaaaaacgattacaacacataaaacggaaagaaagaaat
gaagcctatttgtttatgactgtaaatgttttgtttgaagatagttttaacgggcatcaa
ggaaatgacctttatgaccaagaaaaagcattatatagagtatttcgggtgcgtaagcaa
gcttcacttttagagtttcttgaaatactcagcgaaagtttgaaatattctattggacaa
atccgcatatggccattcagcttaagatctaaccaaacatgcagaccaactttaattgaa
tcggagacagatcttcagaaacctattactgattgcgctgaaagtggcaacccttggaat
atttttgttgaactagcagctcctgattcaggattgacagcattaccagcttttgacaaa
gatacggatgttttattattttttaagttgtatgacccaaaaaaacggaaaatacattat
tgtggtcatcattacatgcctgtaacggctaaagttcaggatcttattccgatattaaac
gaacgagctggttatccagaaaacactgatataattttatatgaagaaataaaaccaaat
atggttgaaaagatagacaatcttgcagagcctcttgaaaaagttttagaagaactaatg
gatggtgatattattgtattccaacgcgaagagaaggaaaacgatatttacgaacttcca
acttgcagagactatttcagagatctatcatttcgtatggaagtaacgttttgcgataaa
acggtaccaaatgatcctggatttttgatggagctgtcacaaaaaattacttatgaacag
atggcaaaagcagtatcgcaacgacttggaacagatccgtatttattacaattttttaaa
tgtcagaattataaagatttaccagggaatcctttaaagtgtacatttgatggaacttta
aaagagttagttgctaattgcaaaccaaaaactaaaaaaatattttatcaacagcttagt
attcatgttaatgaacttgaaaataagaaacaatttaaatgcatttgggtgaatttaact
ctaaaagaagaaaaagaaataatcttgtatcctaataaaaatggtacagtattaaatttg
ttagaagaggcaaaaaaacttgttgagttatcagaaaatggatctggaaaattaagaata
ttggaaattgttagcaataaactgcaacctgaacctaaagaagatgtgccattagaaagt
ttaagtacgaatggatccaaaatttataggatagaagaaattcctaaagacgaattaaat
ttatcagaagatgaaatactggtccctgtagctcattttcataaggatgtattttcaaca
tttggtataccatttttttttaaaattaaacatggagaacctttcctgcaaatgaaagaa
agactttttaagcgactagatatccaagaaaaagaatttgaaaagtttaaatttgccatc
gtaacggctaataaaccgcatttcatcaacgattcgcctgattattgtatggatattgga
gactttaggcctcatcagaatcaaattttccctttatttaactcaggagccaatcagcag
aagccatggttgggattagatcacattaataaagcacctaaacgcaacaggattaattat
ttggagaaagcgataaaaatctataactaa

DBGET integrated database retrieval system