KEGG   Nasonia vitripennis (jewel wasp): 100679733Help
Entry
100679733         CDS       T01081                                 

Definition
histone-lysine N-methyltransferase SETMAR-like
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100679733
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100679733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 342 aa AA seqDB search
MEISEGHFCHILLFYFQEGKTAAQAHRKLYSLYGDECLSERQCQNWFTRFRSGNFDFKDE
PRSGRRTVEKVDETLEKFEIYXHISFYDIAIEPNIDYKTVLNHLHKTEYKKXLDTWVPHK
LKSKNLMDRVSICKSLLKRKEMEPSLKRIITGDDKWIAHDNNVLKRLCLKPGEAPQTVAE
PVLTQGKVLLSVXWDWKRIVHHKLLEPVKTINLTVYCQQLMRLQQAIKKSRPELINRRGV
VFHYDNTRPNISLMTRQKLREFGWKVLMHPPYSLDLSPSNYHLFRSLQNSLNGVTLDSKE
ACKNHLVKFFAQKPQKFYSDKIMVLPEKWRKVIDQNGTYIVV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggagatttcagaaggccacttttgtcacattttgcttttctacttccaagaaggaaaa
actgcagcacaggcccatcgaaaattgtacagtctttatggtgatgagtgcctaagtgaa
cgccagtgtcaaaattggttcactcgatttcgttccggaaacttcgattttaaagatgaa
cctcgctctggtcggcgaaccgttgaaaaagttgatgaaactcttgaaaaattcgagata
tactgacatatttcattttacgacatcgctatagaaccaaacatcgattataaaacagtt
ttgaaccatttacataagactgaatacaaaaaatagctcgatacttgggttccacacaaa
ttaaagtcaaaaaatttaatggaccgagtttccatttgtaaatccctgctgaaacgaaaa
gaaatggagccatctttgaaacgaataattacgggcgatgataaatggatcgcccacgac
aataatgtgctaaagagattgtgtttgaagcccggagaagctccacaaacagttgcggag
cccgtattgacgcaaggaaaggtgttgctgagtgtttagtgggattggaagcgcattgtc
catcataagctgctcgaacctgtaaaaaccattaatttgactgtctactgtcaacaacta
atgcgattgcagcaagctattaaaaaaagccgtccagaattgattaataggagaggcgtt
gtcttccattacgacaacactagaccgaacatatccttaatgactcgtcaaaaattgaga
gagtttggctggaaagttttgatgcatccaccctatagcctggacctttccccgtcgaac
tatcatttgttccggtctctgcaaaactctcttaatggtgtaacgctggattcaaaagaa
gcttgtaaaaatcacttggttaagtttttcgcccagaaacctcagaagttctacagtgac
aaaattatggttttgccagaaaagtggcgaaaggtcatcgatcagaacggtacatatatc
gttgtttag

DBGET integrated database retrieval system