KEGG   Nicrophorus vespilloides: 108560878Help
Entry
108560878         CDS       T04922                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
nvl  Nicrophorus vespilloides
Brite
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108560878
Peptidases [BR:nvl01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108560878
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108560878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 374 aa AA seqDB search
MPMCCGRKKRHTDEFHEFDREDENDRKQSCWPKALKWTAIIILIIAVLLFLTVFVIFPII
FMESISLQRFVMFPNFDQPENPQYENYALYGAVGVKNMYVTVDDIYTSSSKLSLGVWMVV
PEDTIEEAENDPNFDFIQELRRTKKPIIIYFHGNSGTRIYPYPTYQVLRKYFYVVAFDYR
GYGDSTDALLSEAAVVSDSMQLYRYVEGLSKSPKIFVWGHSLGTALSTHTLKELRKQGTV
PSGLILEAPFTTMREEIVYHPLGKIFAWLPWFEPTVLDPLERNKFHFKTTTNILDVDCPI
MILHAEDDSVIPYFLGEKLYEIAKDNRQEKQGPVSYHQIPAKYRADHLEITSHSEVPQWI
EEFLEVARNWHRGF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgtgctgcggaaggaagaagagacacaccgatgagtttcacgaattcgatcga
gaagatgaaaacgacagaaaacaatcctgttggcccaaagcgctcaaatggacagcaatc
ataattttgattatagcggttcttctattcttaacggttttcgtgatattccccattatc
ttcatggagagcatcagtctgcagcgattcgtgatgttccccaattttgatcaacccgaa
aatccgcagtacgaaaactacgctctttacggcgctgtcggtgttaagaacatgtacgtc
acggtcgacgatatttatactagctctagtaaactatctttgggtgtatggatggtcgtg
cccgaggatacgatagaggaggccgaaaacgatccgaactttgacttcatccaagagctc
agacgcaccaagaaacctatcatcatctatttccatggaaacagcggtaccaggatatac
ccttacccaacctatcaagtgctcaggaagtacttctacgtcgtggccttcgattatcgc
ggttacggcgattcaacagacgcgcttttgagcgaagccgctgtagttagcgattccatg
cagctctatcgttacgtcgagggcttgtctaagagtccgaagatcttcgtctggggacat
tctctgggaacagccttatccacgcacacgctcaaagagttgcggaaacaaggaaccgtc
ccttctggcctcatactggaagcccctttcaccactatgagagaagaaatcgtgtaccat
cccttaggaaaaatattcgcgtggttgccatggtttgagccaacagtcttggatcctctt
gaacgcaacaaattccatttcaagactaccaccaacatcctcgacgtggactgtcccatc
atgattcttcacgccgaagatgattccgttataccatacttcctaggtgaaaaactgtac
gaaatagctaaagataacagacaggagaagcagggtccggtcagctatcatcagattcct
gccaagtacagggccgatcatctcgagatcaccagtcactctgaagtgccccaatggatt
gaggaattccttgaggtcgctagaaactggcatcgaggtttttga

DBGET integrated database retrieval system