KEGG   Nitrosococcus watsonii: Nwat_0036Help
Entry
Nwat_0036         CDS       T01266                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nwa  Nitrosococcus watsonii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nwat_0036
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Nwat_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(35983..36471)
Genome map
AA seq 162 aa AA seqDB search
MARAYVSIGSNINRENNIRAGVSALRCSYGPLIISRVFESEAVGFQGDNFYNLVVGFDTD
EAPRMIAHALHEIEQACGRKRDGPRFGPRALDLDLLLYDDLVIDEPGLQVPRDDTLDYAF
VLQPLAEIAPHLPHPVLSKRYADLWAAFDKPLNRLWPVKLDL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgcatatgtcagcattggcagcaacatcaaccgagagaataatattcgtgct
ggagtcagtgcgctgcgctgcagctatggaccccttatcatctcacgggtatttgaaagc
gaggcggtggggtttcaaggcgataacttttacaatctagtcgtcggtttcgatacggat
gaggcacctcgaatgattgcccatgcgcttcatgagattgaacaagcctgtggccgcaag
cgcgatggcccccgctttggtccgcgggctctcgatctggatcttttgctttatgatgac
ttggtaattgatgagccgggactccaagtaccacgggatgatacacttgactatgctttt
gtcctacaaccccttgcagaaattgcgccccacttgcctcaccccgtgctaagcaaacgt
tatgctgatctctgggctgctttcgataaacctttaaaccgtttatggccagtcaagttg
gatctataa

DBGET integrated database retrieval system