KEGG   Nitrosococcus watsonii: Nwat_0096Help
Entry
Nwat_0096         CDS       T01266                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00020  Citrate cycle (TCA cycle)
nwa00310  Lysine degradation
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01120  Microbial metabolism in diverse environments
nwa01130  Biosynthesis of antibiotics
nwa01200  Carbon metabolism
Module
nwa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nwa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nwat_0096
  Amino acid metabolism
   00310 Lysine degradation
    Nwat_0096
Enzymes [BR:nwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Nwat_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ADJ27076
JGI: Nwat_0096
UniProt: D8K881
Position
98261..99568
Genome map
AA seq 435 aa AA seqDB search
MGTEVRVPRLPESVTEAVVGDWHKKPGDRVQRDETLLDLETDKVVLDVPSPGTGILREVK
KEKGATVGSEEVLGIIEVAGEAEEETAQESSPKPMPSKQAQESETWAAEKKKTKADSPET
APPPAPSKEAEAEDMPPLSPAVRRLVREHRLDPREIPATGRDGRLTKADVVQFLQEEEEP
VATPPPPKSPAPAKPAPVPREEGYGVRREAMSQLRQRIAERMLDSQQTTATLSTFNEVSM
QGIMELRRRYRDAFEKRYGVRLGFMSFFIKACIEAFKRYPMVNATIQGNDILYYHYYHIG
IAVATPRGLVVPVLPDADQLNFADIEIRIADFAERAHSGQLTIEELSGGTFTITNGGVFG
SLLSTPILNPPQSAILGMHKIEDRPVAENGEVKIRPMMYVALSYDHRLIDGKEAVQFLVA
VKEALEDPMRLLLEV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggggacagaggtgcgcgtacccagattacccgaatcggtgactgaggcagttgtaggg
gattggcataaaaagccgggcgaccgcgtccagcgggatgaaactttgttggaccttgag
accgataaggtggtgctggatgtcccttctcccggcactgggattttacgggaagtaaaa
aaagaaaaaggcgctaccgtaggcagcgaagaagtccttggaataattgaggttgccggg
gaggcggaggaagaaactgcacaggaatcttccccgaagccgatgccttccaagcaagcc
caggagagtgaaacatgggccgcggaaaaaaagaaaacaaaggctgattccccagagacg
gcgccaccaccagctccttccaaagaggctgaggcggaggacatgccgcccttaagtccc
gcggttcgccgcttggtaagggagcatcggctcgacccgcgggaaattcctgccaccggt
agagatggccgtttgactaaagccgatgtggttcagtttctccaagaggaagaagagccg
gtagctacgcctcctccgccgaaatcaccagcacccgcaaaacccgctccagtaccgaga
gaagagggttatggcgttcggcgggaggccatgagccaattgcggcaacggattgccgag
cggatgctggattctcagcagactacggctaccttgtctacttttaacgaggtgagtatg
caggggataatggaactgcgtcgccgctaccgggatgcctttgaaaaacgctatggagtc
cggctaggctttatgtctttttttattaaagcctgtatcgaagccttcaaacgttacccc
atggtgaacgccacgattcagggcaacgatattctgtattatcattattatcatatcggc
attgcagtggcgacgcctcgcggtttggtggttcccgtgctgccggatgcggatcagctt
aatttcgctgacatcgaaatccggatcgcagactttgccgagcgggcgcacagcggccag
cttacgattgaagagctgagcggtggtacctttaccattactaatggtggagtatttggt
tccctgctctccacgcctatcttaaatccaccccaaagcgctattctcgggatgcacaaa
attgaagatcgaccagtagcggaaaatggcgaggttaaaatccggcccatgatgtacgta
gcgctctcctatgatcaccgccttattgatggcaaagaggctgttcaatttttagtggcg
gtcaaagaggccctagaagatcctatgcggctattgcttgaggtgtga

DBGET integrated database retrieval system