KEGG   Nitrosococcus watsonii: Nwat_0128Help
Entry
Nwat_0128         CDS       T01266                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nwa  Nitrosococcus watsonii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nwat_0128
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Nwat_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
136216..136824
Genome map
AA seq 202 aa AA seqDB search
MIGRLRGILLEKRAPFLLLDVQGVGYELEAPLSTFYVLPAMGAEVILYTHLVVRDDAHLL
YAFASEKERGLFRSLIRVNGVGAKLGLGILSGIEAESFTRCVQEGDTVSLTRLPGIGKKT
AERLIIEMRDRLLDRPESRIAEMCSDTVDGSVPAGTVAEAVSALVALGYKPNDASRTVRR
LDTEGLTTEEIIRRSLQRMLQP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgtttgcggggcattttattggaaaaacgggctccctttttattattggat
gtacaaggcgtaggttatgaactcgaagcccccttgtctacgttctatgtccttcccgcc
atgggcgctgaggtgatcctatacactcatctggtcgtgcgggacgatgcccacctgctg
tatgcttttgctagcgaaaaggagcgcgggctattccggagtctaattcgggttaatggt
gtgggcgctaaattgggattaggcattctttctggcatcgaggccgaatcttttacccgc
tgtgttcaggaaggagatacggtgagcctgacccgattgcctggcataggtaaaaaaacg
gcagaacgcctcattatagagatgcgggatcggctgctcgataggccggagagtagaata
gcagagatgtgctccgatacggttgatgggtctgtcccggcggggacggtggcggaagca
gtcagtgctctggtggcgctgggttataagcctaatgatgctagccggacagtgcgccgc
ctcgataccgagggattgaccacggaggaaatcatccggcggtcattacagcggatgtta
caaccatga

DBGET integrated database retrieval system