KEGG   Nitrosococcus watsonii: Nwat_0202Help
Entry
Nwat_0202         CDS       T01266                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
209879..210157
Genome map
AA seq 92 aa AA seqDB search
MSIVGILIWTLAMVGAVVYAQYRIPFHATNTTQSWVVRLMLVVVGVGVGFVSVSRYQGSA
SMPPVLAFLNGFGAAHVPAAFILWMKGRDSVP
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagtagggatattgatttggactttagccatggtgggcgcggtagtttatgcc
cagtaccgcatcccctttcatgctacgaataccacccaaagctgggtggtccgcttgatg
ctggtggtggtaggcgtgggtgtgggttttgtttcggtaagccgttatcaaggaagtgca
agtatgcctccagtgctagcttttcttaatggttttggcgccgcgcatgtgccggctgct
tttattttatggatgaaggggagagacagcgttccttaa

DBGET integrated database retrieval system