KEGG   Nitrosococcus watsonii: Nwat_0208Help
Entry
Nwat_0208         CDS       T01266                                 

Definition
(GenBank) urease, gamma subunit
  KO
K01430  urease subunit gamma [EC:3.5.1.5]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00220  Arginine biosynthesis
nwa00230  Purine metabolism
nwa01100  Metabolic pathways
nwa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Nwat_0208
  Amino acid metabolism
   00220 Arginine biosynthesis
    Nwat_0208
  Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    Nwat_0208
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     Nwat_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urease_gamma Rib
Motif
Other DBs
NCBI-ProteinID: ADJ27179
JGI: Nwat_0208
UniProt: D8K8W9
Position
214929..215231
Genome map
AA seq 100 aa AA seqDB search
MELTPREKDKLLIFTAGLVAERRRERGLKLNYPEAVAYISAAVLEKAREGMSVAELMHHG
TTLLTRDDVMEGVPEMISDIQVEATFPDGTKLVTVHHPIA
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggaactcaccccacgggaaaaagacaagttgctaattttcactgcgggcttggtagct
gaaagacgccgcgagcgaggtttgaaactcaactatccagaggcggtagcgtacatttcc
gcagccgtgctggagaaagcgcgggagggtatgagcgttgcggagctgatgcaccatggc
acgactttattgacccgggatgacgtcatggaaggagtgccggaaatgatttctgatatc
caggtggaggccacctttcccgatggcaccaagctggtgacggtccaccatcctattgcc
taa

DBGET integrated database retrieval system