KEGG   Nitrosococcus watsonii: Nwat_0211Help
Entry
Nwat_0211         CDS       T01266                                 

Definition
(GenBank) UreE urease accessory domain protein
  KO
K03187  
urease accessory protein
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
217283..217786
Genome map
AA seq 167 aa AA seqDB search
MLCFERRLPRDTPADVEMAFTFEQRERSRLRFQLPDGREAAFLIERGAPLAEGERLGTAE
GLVLAIQAEPEPLMEVRSSDSLALVRAAYHLGNRHVRLEIGAHWLRLPPDYVLRDMLTRL
GVEVFEVTAPYQPESGAYGGGHHHSHSHHEGDEFHSQPRLHHFGERQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgtttcgagcggcgtctgcctagagatactcccgcggatgtggagatggctttt
acttttgaacagcgggagcgcagtcggttgcgcttccaattacccgatggccgcgaggcc
gcttttcttatcgaacggggcgcacctttggcagaaggagaacgtttgggaacggcggaa
ggcctggtgctggccatccaggctgagcccgagccattgatggaggtacgttcctccgat
tcgcttgctttagttcgggctgcctatcatctgggcaatcgccatgtgcgtttggagata
ggagcgcactggctgcgtttaccgccggattatgtgttgcgggatatgctaacgcgtctc
ggcgtggaagtctttgaggttaccgctccttatcaacccgaatcgggtgcttatggagga
ggccatcatcatagtcacagccatcatgagggggatgaattccattcccagccccgcttg
caccatttcggagagcgccaatga

DBGET integrated database retrieval system