KEGG   Nitrosococcus watsonii: Nwat_0217Help
Entry
Nwat_0217         CDS       T01266                                 

Definition
(GenBank) cation diffusion facilitator family transporter
  KO
K13283  ferrous-iron efflux pump FieF
Organism
nwa  Nitrosococcus watsonii
Brite
Transporters [BR:nwa02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Nwat_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux ZT_dimer
Motif
Other DBs
NCBI-ProteinID: ADJ27187
JGI: Nwat_0217
UniProt: D8K8X7
Position
223396..224355
Genome map
AA seq 319 aa AA seqDB search
MKAQTENKLEKAISSSETTLISHDHARIMQRATYAAVSVAAMLVVIKFGAYLVTGSVAML
SALIDSALDVAASLINLFAVRTALTPADQEHRFGHGKAEPLAGLGQAAFITGSALFLAVE
SIRLLWVPQPVENGALGIGVMVVSIMLTLALVYYQRGVIRKTGSLAISADSLHYTGDVLV
NLGVIAAIGLSSLGGWTLADPLFALGIAAYILWTAWQIIFRSLDQLMDRELPEEKRAQIA
QLALSHPEVLDFHDLRTRAAGQTIFIQFHLGVDGQLSLHQAHRIGKEVEAKVLNIFPQAE
IIIHQDPIDKDKKDSLGQH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctcaaaccgaaaataagcttgaaaaggcgatatcttcttcggaaactaccctg
atatcccatgaccatgcccggattatgcaacgtgccacctacgccgccgtgtcggtggca
gcaatgcttgtggtaattaagttcggcgcttacctagtgacgggctctgtggcgatgctc
tccgctctgattgactcggccctagatgtggcggcttccctgattaatttgtttgcagtg
cgtaccgcgcttacgccggccgatcaggagcaccgtttcggtcatggtaaagctgaaccc
ttggctggactgggccaggcagcctttattaccgggtctgcgctttttctagcagtagaa
tccataagattactatgggtaccgcagccagtagaaaatggcgctttaggtataggcgtg
atggtcgtatccattatgttgacgcttgccttagtctactatcagcgcggcgtaatacgt
aagacgggttccctggcgattagcgcggattcgctccattacacgggggatgtgctggtt
aatttgggggttatagcggctatcgggttaagctcgcttgggggttggactctggctgat
ccactgtttgcgttgggtattgcagcttatattttatggactgcctggcaaattattttc
cgctcgctggaccaactcatggaccgggaactgccggaggaaaaacgagcacagattgcc
cagctcgctttatcccatcctgaagtgctcgatttccatgatctccggacacgagctgcc
ggtcaaactatatttattcaatttcatttaggcgtggatgggcagttaagtttgcaccaa
gcccatcggataggaaaagaggtagaggctaaggttttgaatatttttccccaagcagag
attattatccaccaggatccgatagataaggacaagaaggattcgctcggacaacattaa

DBGET integrated database retrieval system