KEGG   Nitrosococcus watsonii: Nwat_0221Help
Entry
Nwat_0221         CDS       T01266                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  
cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
nwa  Nitrosococcus watsonii
Pathway
Peptidoglycan biosynthesis
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nwat_0221
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Nwat_0221
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Nwat_0221
Peptidoglycan biosynthesis and degradation proteins [BR:nwa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Nwat_0221
Chromosome [BR:nwa03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Nwat_0221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
226693..228405
Genome map
AA seq 570 aa AA seqDB search
MVSRRERDKNYPGRLGVVGLAFAVAVAGLAWRLVELQVLDCDFLRGEGEARHLRVVEMPA
HRGIITDRHGEPLAVSTPVASIWFNPRLLGEAREQWRALAEAAGVSMAHLEKRMKEGGRR
EFVYLNRWVEPDVAQRVQALEVPGVNLQSEYRRYYPTGPVAAHVVGFTNIDDRGQEGLEL
ALDETLRGIPGKKRVIQDSRGRVVEDVENLRVPRPGQDLRLSIDLRLQYLAYRELKTAVQ
DHNARAGSLVILDVGTGEVLAMVNQPSYNPNDRAQLKSHLYRNRAVTDLFEPGSTIKPFT
IGVALESGKYYPHTPIDTAPGYFRVGRYTIRDSRDYGRIDVSTVIKKSSNVGASKIALSL
DPMRLWQGFYQAGLGTSTASGFPGEAEGHLPRSRTFPFREIEQATLAFGYGLSVTPLQLA
RAYAALGAGGELKPVSFLYREQAVREHQVWSEGIAPTVLSMLEEVVSDGGTGERAYVPSY
RVAGKTGTVKKATRGGYAKERYLAVFAGLIPASHPRLAAVVLIDEPQGKYYGGQVAAPVF
SKVMIGAMRLLNIAPDNLPPLHLAERENTE
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggtaagccgacgagaacgcgataagaattatcctggccgcttaggggtcgtagggctt
gcttttgctgtagctgtcgcagggctggcctggcgcctcgtcgagttgcaagtgctcgac
tgcgacttcttgcgaggggaaggagaggcccgtcaccttcgggttgtggaaatgccagcc
catcggggcatcattactgatcgtcatggtgagcctctggccgtgagtacacccgtggct
tcgatatggttcaatcctcgtctgctaggtgaagccagagaacaatggcgagccctggca
gaagcagcaggtgtttccatggctcatctggagaagcggatgaaagagggaggtaggcgg
gagtttgtatacctgaatcgttgggtcgaacctgatgtggcccagcgagtacaagcccta
gaggttcccggtgtaaatctccaatcagaataccggcgttattatcctacgggcccagta
gcagcccatgtggtggggtttaccaatattgatgatcgtggtcaggagggcctggaatta
gctcttgatgagaccctgcgggggattccgggtaaaaagcgagttatccaggatagtcgt
ggacgggtagtggaggatgtggagaatctgagggtcccgcgaccaggacaagatctgcgc
ttaagcattgatttgcggcttcagtatttagcttatcgggagctgaaaacggcggttcag
gaccataatgcccgggctggttcattggtgatcctggatgttggcaccggtgaagtttta
gcgatggtgaatcagccctcttacaatcccaatgatcgtgcccagctgaaaagccattta
tatcgtaatcgggcagtcacggatttatttgagcctggttctactattaagcctttcacc
ataggggtagcgctggagtcgggaaagtattatccccatactcctattgatacagcaccc
ggttacttccgggtaggacgttacaccattcgtgatagtcgcgattatggccgtattgat
gttagcacggtgattaaaaaatcaagcaatgtaggcgcaagcaaaatcgccttaagtctc
gatccgatgcgcctctggcagggtttttaccaggcggggctagggacctcaacggccagt
ggcttccctggcgaggcggaaggccatttaccccgttctcgcactttcccttttcgggaa
attgaacaggccacgctggcatttggttacggtctttcggtcaccccgttgcagttagcc
cgggcttacgcagctttaggggcgggaggtgagctaaagccagtcagtttcctttatcga
gaacaggctgtaagagagcatcaggtgtggtctgagggcatcgcgcctacagtgttatcc
atgcttgaagaggtggtgagtgatggcggcacgggagagcgagcctatgttcctagttat
cgggtggcgggtaagacaggtacggtgaaaaaagcgactcggggtggatatgctaaggaa
agatatcttgctgtatttgctggtcttatccctgccagccatcctcgtttggcggcggtg
gtgctgatcgatgaaccccaggggaaatactatgggggccaagtggcagccccggtgttt
tctaaagtaatgatcggggcgatgcgattgctgaacattgcgccggacaatttgcctccc
ttacatttagcggagcgggaaaatactgagtaa

DBGET integrated database retrieval system