KEGG   Nitrosococcus watsonii: Nwat_0225Help
Entry
Nwat_0225         CDS       T01266                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00471  D-Glutamine and D-glutamate metabolism
nwa00550  Peptidoglycan biosynthesis
nwa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Nwat_0225
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nwat_0225
Enzymes [BR:nwa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Nwat_0225
Peptidoglycan biosynthesis and degradation proteins [BR:nwa01011]
 Precursor biosynthesis
  Amino acid ligase
   Nwat_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C DAO NAD_binding_8 ArgK Thi4
Motif
Other DBs
NCBI-ProteinID: ADJ27195
JGI: Nwat_0225
UniProt: D8K8Y5
Position
232519..233877
Genome map
AA seq 452 aa AA seqDB search
MLNEPLRSQAAVVSVIIGLGKTGLSSARFLASRGFPIAVMDSREFPPGLAALQEHNPDVV
LRLGGFDAALIAEAEQLVVSPGVALSEPAIQVAQARGIPVIGDIELFASYAKAPVIGITG
SNGKSTVTSLLEMMARQAGKQVLAGGNLGLPALELLEKPVPDLYILELSSFQLETTYTLN
TVAACVLNISPDHMDRYPDLDAYFQAKARIYRGTGTMIINTDDFRVASLAQPHRSCLRFT
LGNPNNNEYGLREYGGEIWLARGHEELLSTRRLPLAGRHNLANALAALALGEAAGLPRAA
MLSALQVFPGLPHRCEWLAEVKGVRWYNDSKGTNVGATVAAIEGMPCQGKLVLIAGGVGK
GADFSPLREPLVQRARAVVLIGQDASRLEAVLAGGLPLYRANSMGEAVAKASALAQSGDC
VLLSPACASFDMYADFEARGQAFRQAVQEISL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgaacccctacgatcccaggcggcagtagttagcgtgatcattggtctcggt
aaaaccgggctatcgagtgcccgcttcctagctagccgcggtttccccatagcagttatg
gacagtcgtgagttcccgccaggactcgccgccctccaggagcacaatcctgacgtggtg
ctccggctgggtggttttgatgctgccctgatagcggaggctgaacaattggtcgtcagt
cctggcgtggccttgagtgagccagcaatccaggtagctcaggcaagaggaatacctgtg
ataggagatattgaattatttgcttcctatgccaaggcgcccgtgatagggattaccgga
tctaatggtaaaagcactgtgacctcgctgcttgagatgatggcgcgccaagccggtaaa
caggtgctcgcggggggtaacctgggactccccgccctggaattactagaaaaacccgtg
ccggacctttatatcttggaattatccagctttcaattagagactacctataccctaaat
acggttgctgcttgcgtacttaatatcagtcccgatcatatggatcgatatcctgatcta
gatgcttatttccaggcaaaagccaggatttaccgggggactgggacgatgattattaac
accgacgattttcgtgtagcaagcctcgcgcaaccccatcggtcttgtcttcgatttacc
ctagggaatccaaataataatgaatatgggctacgggaatatgggggggaaatatggttg
gcgcgggggcatgaagagctattatcaacccggcggttgcccttggctggacgccataat
ctggccaatgccttggccgcgttggccctgggggaggctgcgggactgcctcgcgccgcg
atgttgtcagctttacaggtattccccggtttacctcaccgttgcgagtggttagcggag
gtaaagggagtgcgttggtataacgactccaagggaactaacgtaggcgctacggtggcg
gcgattgaagggatgccctgccaaggaaagctggtgctcattgcggggggtgtcggcaag
ggcgcggatttttctcctttacgggagcctttagtccagcgggctagggcagtcgtctta
ataggtcaagatgcttcccgattggaagcggtattggccggcggtctccccctctatcgg
gccaatagcatgggtgaggccgtggctaaagcgagcgccttagctcaatccggtgattgt
gttttgctctcccctgcctgcgctagctttgatatgtatgctgattttgaggctcgcggt
caggcgtttaggcaagccgtgcaggaaatatcattatga

DBGET integrated database retrieval system