KEGG   Nitrosococcus watsonii: Nwat_0233Help
Entry
Nwat_0233         CDS       T01266                                 

Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
nwa  Nitrosococcus watsonii
Brite
Chromosome and associated proteins [BR:nwa03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Nwat_0233
Cytoskeleton proteins [BR:nwa04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   Nwat_0233
Prokaryotic defense system [BR:nwa02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Nwat_0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C
Motif
Other DBs
NCBI-ProteinID: ADJ27203
JGI: Nwat_0233
UniProt: D8K8Z3
Position
241456..242613
Genome map
AA seq 385 aa AA seqDB search
MFELMDSYTQSAVIKVIGVGGGGGNAIRHMVDAKIEGVDFIVANTDAQALKDCAAPTVLQ
LGNNITKGLGAGADPEIGRQAALEDRERIMEVVSGADMVFITAGMGGGTGTGGVPVVAQV
TKELGVLTVAVVTRPFSFEGRKRAAIADEGIKELTQYVDSLITIPNEKLMPVLGKSISLL
NAFKAANDVLLGAVQGIAELITRPGLINVDFADVRTVMAEMGMAMMGSGSATGEERARLA
AEAAVASPLLEDISLKGARGVLVNITGGPSMSIGEFEEVGSTVKEYAADNATVVVGTVID
PGLENELRVTVVATGLGRPETQTKAPISLAQISSQQSELEEPVDYHTLDKPTVIRHGSSR
DPVTTSSDSSMDYLDVPAFLRRQAD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaattgatggattcatatactcaaagtgcggtgatcaaggtcattggcgtcggt
gggggaggcggcaacgccattcggcatatggtggacgctaaaatagaaggggtcgatttc
attgttgccaatacggatgctcaagccctcaaggactgtgccgcccctacagtgctgcaa
ctgggcaacaatatcaccaaaggattaggggccggggctgatccggaaattggccgccaa
gctgctctggaggaccgggagcggattatggaagtagtgagcggtgcggatatggtattt
atcactgccggtatgggtggtggtactggaacaggcggcgttcctgtggtggcccaagtc
actaaggaactcggggttttgactgtcgccgtggtgactcggcctttttcctttgagggg
cgcaagcgtgcggccatcgctgatgaaggaattaaggagctaacccagtatgttgattct
ttgattaccataccgaatgaaaaattgatgccggtgctaggtaaaagcattagcctgtta
aatgctttcaaggcggctaatgatgttttgctcggcgcagtgcagggaattgccgaactt
attactcggcctggcttgattaatgtggattttgccgacgttcgcaccgtcatggcggaa
atgggaatggccatgatggggtccggcagcgccacgggagaggaacgagcccgtttggcg
gccgaagcggcggtagcaagtcccttgctagaagatatcagcctaaaaggtgctcgcggg
gtactggtcaatatcacggggggacccagcatgtctattggcgaattcgaggaggttgga
agtacagttaaagaatatgccgcagacaatgcaaccgttgtggtgggtaccgtgattgat
cctggcttggaaaatgaactgcgggttacggtggtggctactgggctaggacggccggag
acacaaacaaaagcgcccatcagtcttgcgcagatttcttctcagcagtctgaacttgaa
gaacctgttgattatcatactttggataagcctaccgttatccgccatggttcatcgcga
gatccagtcacaacgagcagcgattctagcatggattatttagatgttccggcgtttttg
cgccgacaggccgattga

DBGET integrated database retrieval system