KEGG   Nitrosococcus watsonii: Nwat_0242Help
Entry
Nwat_0242         CDS       T01266                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nwa  Nitrosococcus watsonii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:nwa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:nwa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nwa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:nwa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nwa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nwa00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:nwa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
251526..252791
Genome map
AA seq 421 aa AA seqDB search
MAKKNAFYAQSGGVTAVINASACGVIETARQHPEVIGKVYAGRNGIIGALTEDLIDTSQD
SNNDIAALRHTPGGAFGSCRYKLKGLEENKAEYERLIEVFKAHDIGYFFYNGGGDSQDTA
HKVSQLGERLGYPITCIGVPKTVDNDLPITDNCPGFGSVAKYVAVSVREAALDVVSMART
STKVFILEVMGRHAGWIAAAGGLAAEREGDAPHIILFPEIPFEQGQFLEKVDASVKDYGY
CVVVASEGVRNQEGQFLSETGSRDAFGHAQLGGVAPFIARMVKEQLGYKYHWAVADYLQR
AARHIASQVDVEQAYAVGKAAVEFAIRGKNAVMPTILRASHDPYRWEIGSAPLKDVANVE
KTLPRSYITQEGFGITEEGRRYLAPLIQGEDYPPYKNGLPDYVELKNVPVEKKLKEAFTL
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaagaatgcattttatgctcaatctggcggcgtgactgcggttatcaatgct
tctgcctgcggcgttattgaaacggcgcggcagcatccggaggtcattggcaaagtttat
gccgggcgtaatggcatcattggggccttaaccgaagatcttatcgataccagccaggac
agcaataatgacattgctgctttacggcatacgccgggaggagcttttgggtcttgccgg
tataaactcaagggactcgaggaaaacaaggctgagtatgaacgtctgattgaggtgttc
aaggcacacgatattggctatttcttttataatggcggtggcgactctcaggacaccgcc
cacaaagtctcccagcttggggagcggctaggatatcccatcacgtgtattggggttcct
aagaccgtcgataatgacttgccgattactgataactgcccgggttttggatctgtagcg
aaatatgtggcagtttcagtgcgagaggcagccttggatgtggtctccatggcccgaact
tcgacaaaagtttttatccttgaagtgatgggacgccatgcaggttggattgccgctgcg
ggcgggctagcagcagagcgggaaggagacgctcctcacatcattttatttcctgaaatc
cccttcgagcaagggcaattcctagagaaggtggatgccagcgtcaaggattatggctat
tgcgtggtggtagcttcggaaggtgttcgtaaccaggaaggccaatttttatctgaaacc
gggtcgcgggatgccttcggccatgcccagctgggtggggtagctccttttattgcccgg
atggtgaaagagcagttgggttataaatatcattgggcggttgctgattatttgcagcgg
gcagcacggcatatcgcctcccaggtggatgtggagcaagcctatgcggtgggcaaagcg
gctgtagaattcgccatcagaggtaaaaatgcggtgatgcctactatcctccgcgcctct
cacgatccctatcgttgggagattggttcagcgcccctaaaggacgtagccaatgtggag
aaaaccctgccccgaagctatatcactcaagaagggtttggtattacggaagaggggcgg
cgctaccttgctcccttaattcaaggagaagattatcctccctataaaaatggattaccc
gactatgttgagctcaaaaatgttccggttgagaagaaactcaaggaagcatttacctta
cgctga

DBGET integrated database retrieval system