KEGG   Nitrosococcus watsonii: Nwat_0243Help
Entry
Nwat_0243         CDS       T01266                                 

Definition
(GenBank) peptidase S49
  KO
K04773  protease IV [EC:3.4.21.-]
Organism
nwa  Nitrosococcus watsonii
Brite
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Nwat_0243
Peptidases [BR:nwa01002]
 Serine Peptidases
  Family S49: protease IV family
   Nwat_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S49 SDH_sah CLP_protease OKR_DC_1_N ECH_1 Prok-TraM
Motif
Other DBs
NCBI-ProteinID: ADJ27213
JGI: Nwat_0243
UniProt: D8K903
Position
complement(252885..253862)
Genome map
AA seq 325 aa AA seqDB search
MSNQDAPTTDLSKTQEIQRNWERDVLERLAFSALKEQRRARRWSIFFKILFAAYLLALLL
LYLPNGLSAPGITAPHTALVNIEGIIGADSFANAENIKKGLKAAFENEHIAGLILHINSP
GGSPVQASQINDQVHQLRKKHPDIPIHAVITDICASGGYYIAVAADQIYADKASIVGSIG
ALINSFGFVEAMEKLGIERRLFTAGDYKGFLDPFSPMKEFEAQHIQKMLDNIQKQFIQVV
KDNRGDRLKNDSSLFTGLVWTGEQAIDLGLIDGLGNSSYVAREIIGAEKIIDYTPKPKLL
DRFSRQLGATFANMLSGFTLAASTR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccaagatgcaccgacaaccgatctaagcaaaacgcaggaaatccaacgcaac
tgggagcgagacgtcctggaacgtttggcttttagcgcgcttaaagaacaacggcgggca
cgtcgttggagtatttttttcaaaatactctttgcggcctatttacttgctctcttactg
ctttatcttcccaatgggcttagcgctccaggaataactgccccccacaccgccttagtg
aacatagaaggaatcattggcgccgactcgtttgcaaatgcggaaaatataaaaaaagga
ctaaaagccgcctttgaaaacgagcatatcgcggggttaatactgcatatcaatagtcct
ggaggcagcccagttcaggcaagtcaaatcaatgaccaagttcatcaactgcgcaaaaaa
catcctgatattcctatccacgccgttattacagacatctgcgcctcgggaggatattac
attgcagtagcggcggatcaaatttatgcggacaaagcaagtatcgtgggttccattggt
gctctaatcaatagtttcggcttcgtggaagctatggaaaaactagggattgaacggcgc
ctctttactgcaggcgactataaaggctttcttgatccattctcgcctatgaaagaattc
gaagcccaacatatccaaaagatgctagacaatattcaaaagcaattcattcaagttgta
aaagacaaccgcggagatcgactcaagaacgattcttccctattcaccggcttggtctgg
acaggcgagcaagctatcgatctaggtttgattgatggcttgggaaacagtagctatgtg
gcccgcgagattataggagcggaaaaaattatcgattacacccccaagcctaaactccta
gatcgtttctctcgccagcttggagctacctttgctaatatgctgtccggcttcaccctt
gcggctagtacaagataa

DBGET integrated database retrieval system