KEGG   Nitrosococcus watsonii: Nwat_0255Help
Entry
Nwat_0255         CDS       T01266                                 

Definition
(GenBank) ABC-2 type transporter
  KO
K01992  
ABC-2 type transport system permease protein
Organism
nwa  Nitrosococcus watsonii
Module
ABC-2 type transport system
Brite
Transporters [BR:nwa02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Nwat_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(264731..265507)
Genome map
AA seq 258 aa AA seqDB search
MSRAQRHYIAFKTLVIKEVRRFARIWVQTLLPPAVTMTLYFIIFGSLIGARIGPMEGFSY
MEYIAPGLIMMAVITHSYSNVVSSFFSAKFQRYVEELLISPTPPSIILAGYVVGGAVRGL
MVGLLVLFIALFFTHLKVEHPLITCAVAILTAIVFALGGFINATFANNFDDISIVPNFIL
TPLTYLGGVFYSINLMPEFGQTLSLFNPILYMVNAFRYGILGVSDINIWMAFALISVFLI
GLTALALYLLRKGVGIKT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcacaacgtcattacattgcctttaagaccctagttattaaggaggtccgg
cgattcgctcgcatttgggtccaaaccctgctgccgccagcggtgaccatgacattgtat
ttcattatctttggcagcctcatcggcgcccgcattggccccatggaaggttttagctac
atggaatacatcgcccccggcctgatcatgatggcggtcattacccattcttattccaat
gtggtgtcctcctttttcagcgctaaattccaacgctatgtggaagagctgctgatttca
ccgaccccccctagcattattctggcaggctacgtggtaggcggcgcggtgcgaggtctg
atggtcggcttgcttgtgctgtttatagcgcttttttttacccacttaaaggtagaacat
cccctcattacctgcgccgttgccatattgactgccattgtctttgccctggggggattt
attaacgccacgtttgctaataactttgacgatatttctatcgtccccaatttcatcctg
acccccctgacttatctggggggcgttttttattccatcaatctgatgccggaatttggc
caaaccctttccctctttaaccctattctctatatggttaatgccttccgctacggcatt
ttaggggtatcggatatcaatatctggatggctttcgcccttatctcagtattcctgata
gggctaacggccttggctctctatttactgcgcaagggagtagggataaaaacctaa

DBGET integrated database retrieval system